anti-Human PIK3R6 Antikörper für Immunohistochemistry

Recommended PIK3R6 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Phosphoinositide-3-Kinase, Regulatory Subunit 6 (PIK3R6) Antikörper
  • C17orf38
  • HsT41028
  • p84
  • p84 PIKAP
  • p87(PIKAP)
  • p87PIKAP
  • BB220380
  • RGD1560850
  • phosphoinositide-3-kinase regulatory subunit 6
  • phosphoinositide-3-kinase regulatory subunit 5
  • phosphoinositide-3-kinase, regulatory subunit 6
  • PIK3R6
  • Pik3r6
Reaktivität
Human
13
5
5
1
1
1
Wirt
Kaninchen
8
5
Klonalität
Polyklonal
Applikation
Immunohistochemistry (IHC)
12
3
2
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4238207
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN1885904 IF IHC WB Rabbit AA 1-324 Anmelden zum Anzeigen Polyclonal 0

General

Antigen Phosphoinositide-3-Kinase, Regulatory Subunit 6 (PIK3R6) Antikörper
Reaktivität Human
(13), (5), (5), (1), (1), (1)
Wirt Kaninchen
(8), (5)
Klonalität
Polyklonal
Applikation Immunohistochemistry (IHC)
(12), (3), (2), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-PIK3R6 Antikörper

Target Details PIK3R6 Anwendungsinformationen Handhabung Bilder
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids:PAAPVTDHTCLNVNVTEVVKSSNLAGKSFSTVTNTFRTNNIQIQSRDQRLLTLSLDKDDQRTFRDVVRFEVAPCPEPCSGAQKSKAPWLNLHGQQEVEAIKAKPKP
Isotyp IgG

Target Details PIK3R6

Produktdetails anti-PIK3R6 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung PIK3R6 (PIK3R6 Antibody Abstract)
Hintergrund Gene Symbol: PIK3R6
Gen-ID 146850
Pathways PI3K-Akt Signalweg, Inositol Metabolic Process

Anwendungsinformationen

Produktdetails anti-PIK3R6 Antikörper Target Details PIK3R6 Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry 1:20 - 1:50For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-PIK3R6 Antikörper Target Details PIK3R6 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-PIK3R6 Antikörper Target Details PIK3R6 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Phosphoinositide-3-Kinase, Regulatory Subunit 6 (PIK3R6) antibody (ABIN4238207) Immunohistochemistry-Paraffin: PIK3R6 Antibody - Staining of human placenta shows di...