anti-Maus PDK2 Antikörper für Immunocytochemistry

Recommended PDK2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Pyruvate Dehydrogenase Kinase, Isozyme 2 (PDK2) Antikörper
  • 3j828
  • MGC52849
  • MGC132353
  • Pdk
  • zgc:56209
  • PDK2
  • PDHK2
  • PDKII
  • pyruvate dehydrogenase kinase 4 L homeolog
  • pyruvate dehydrogenase kinase, isozyme 2b
  • pyruvate dehydrogenase kinase 2
  • pyruvate dehydrogenase kinase, isoenzyme 2
  • pdk4.L
  • pdk2b
  • PDK2
  • Pdk2
Reaktivität
Human, Maus
146
93
57
13
5
2
2
2
1
1
1
1
1
1
Wirt
Kaninchen
121
42
Klonalität
Polyklonal
Konjugat
Dieser PDK2 Antikörper ist unkonjugiert
9
9
8
7
7
7
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
148
95
80
33
24
13
5
3
3
2
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4344598
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN1860173 ICC IHC WB Rabbit IgG AA 155-379 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2626695 ICC IHC IHC (p) WB Rabbit IgG AA 379-392 Anmelden zum Anzeigen Polyclonal 0
1 ABIN6259149 ELISA ICC IF WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN3032416 ICC IHC (p) WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal 0

General

Antigen Pyruvate Dehydrogenase Kinase, Isozyme 2 (PDK2) Antikörper
Reaktivität Human, Maus
(146), (93), (57), (13), (5), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Wirt Kaninchen
(121), (42)
Klonalität
Polyklonal
Konjugat Dieser PDK2 Antikörper ist unkonjugiert
(9), (9), (8), (7), (7), (7), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(148), (95), (80), (33), (24), (13), (5), (3), (3), (2), (1), (1), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-PDK2 Antikörper

Target Details PDK2 Anwendungsinformationen Handhabung Referenzen für anti-PDK2 Antikörper (ABIN4344598) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KTSFTFLRQELPVRLANIMKEINLLPDRVLSTPSVQLVQSWYVQSLLDIMEFLDKDPEDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTYGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLIFDGSTN
Isotyp IgG
Plasmids, Primers & others

Target Details PDK2

Produktdetails anti-PDK2 Antikörper Anwendungsinformationen Handhabung Referenzen für anti-PDK2 Antikörper (ABIN4344598) Bilder zurück nach oben
Antigen
Andere Bezeichnung PDK2 (PDK2 Antibody Abstract)
Hintergrund Gene Symbol: PDK2
Gen-ID 5164
Pathways PI3K-Akt Signalweg, RTK Signalweg, Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process

Anwendungsinformationen

Produktdetails anti-PDK2 Antikörper Target Details PDK2 Handhabung Referenzen für anti-PDK2 Antikörper (ABIN4344598) Bilder zurück nach oben
Applikations-hinweise Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-PDK2 Antikörper Target Details PDK2 Anwendungsinformationen Referenzen für anti-PDK2 Antikörper (ABIN4344598) Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen für anti-PDK2 Antikörper (ABIN4344598)

Produktdetails anti-PDK2 Antikörper Target Details PDK2 Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Hou, Zhang, Han, Ge, Ma, Zhang, Moley, Schedl, Wang: "Differing roles of pyruvate dehydrogenase kinases during mouse oocyte maturation." in: Journal of cell science, Vol. 128, Issue 13, pp. 2319-29, 2015 (Probematerial (Species): Mouse (Murine)). Weitere Details: Immunocytochemistry,Immunofluorescence

Bilder

Produktdetails anti-PDK2 Antikörper Target Details PDK2 Anwendungsinformationen Handhabung Referenzen für anti-PDK2 Antikörper (ABIN4344598) zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Pyruvate Dehydrogenase Kinase, Isozyme 2 (PDK2) antibody (ABIN4344598) Immunocytochemistry/Immunofluorescence: PDK2 Antibody [NBP1-87307] - Staining of huma...
Immunofluorescence (IF) image for anti-Pyruvate Dehydrogenase Kinase, Isozyme 2 (PDK2) antibody (ABIN4344598) Immunocytochemistry/Immunofluorescence: PDK2 Antibody [NBP1-87307] - Staining of huma...
Western Blotting (WB) image for anti-Pyruvate Dehydrogenase Kinase, Isozyme 2 (PDK2) antibody (ABIN4344598) Western Blot: PDK2 Antibody [NBP1-87307] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Pyruvate Dehydrogenase Kinase, Isozyme 2 (PDK2) antibody (ABIN4344598) Immunohistochemistry-Paraffin: PDK2 Antibody [NBP1-87307] - Staining of human heart m...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Pyruvate Dehydrogenase Kinase, Isozyme 2 (PDK2) antibody (ABIN4344598) Immunohistochemistry-Paraffin: PDK2 Antibody [NBP1-87307] - Staining of human pancrea...
Immunofluorescence (IF) image for anti-Pyruvate Dehydrogenase Kinase, Isozyme 2 (PDK2) antibody (ABIN4344598) Immunocytochemistry/Immunofluorescence: PDK2 Antibody - Immunofluorescent staining o...