anti-Human NCF1 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended NCF1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Neutrophil Cytosol Factor 1 (NCF1) Antikörper
  • NCF1A
  • NOXO2
  • SH3PXD1A
  • p47phox
  • Ncf-1
  • p47
  • neutrophil cytosolic factor 1
  • NCF1
  • Ncf1
Reaktivität
Human
251
107
93
15
14
11
11
7
5
1
1
Wirt
Kaninchen
226
42
1
Klonalität
Polyklonal
Konjugat
Dieser NCF1 Antikörper ist unkonjugiert
7
7
7
4
4
4
2
2
2
2
2
2
2
2
2
2
2
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
221
154
132
59
38
27
14
12
12
6
2
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4338258
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
10.880302 ABIN750643 IF (p) IHC (p) WB Rabbit IgG AA 165-210 Anmelden zum Anzeigen Polyclonal 0
10.880302 ABIN337093 ELISA IF IHC IHC (p) WB Goat AA 378-390 Anmelden zum Anzeigen Polyclonal 0
10.880302 ABIN337271 IHC IHC (p) WB Rabbit IgG N-Term Anmelden zum Anzeigen Polyclonal 0
10.880302 ABIN4338255 ICC IF IHC IHC (p) WB Rabbit IgG Center Anmelden zum Anzeigen Polyclonal 0
10.880302 ABIN5611556 EIA IHC (p) WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal 0
10.880302 ABIN498263 IF IHC (p) WB Rabbit Anmelden zum Anzeigen Polyclonal 0
10.880302 ABIN4338259 IHC IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN652063 IHC (p) WB Rabbit Ig Fraction AA 26-52, N-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN372580 EIA IHC (p) WB Goat IgG C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN2878785 ELISA IHC IHC (p) WB Rabbit IgG AA 341-390 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2855524 ICC IF IHC (p) WB Rabbit IgG Center Anmelden zum Anzeigen Polyclonal 0
1 ABIN256632 ELISA IHC (p) WB Goat C-Term Anmelden zum Anzeigen Polyclonal 1
1 ABIN2889156 ELISA IHC IHC (p) WB Rabbit IgG AA 311-360 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2888918 ELISA IHC IHC (p) WB Rabbit IgG AA 331-380 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2888916 ELISA IF IHC IHC (p) Rabbit IgG AA 301-350 Anmelden zum Anzeigen Polyclonal 0
1 ABIN5531686 IHC (p) WB Rabbit Ig Fraction AA 26-52, N-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN6283275 ELISA IHC (p) WB Rabbit IgG AA 310-390 Anmelden zum Anzeigen Polyclonal 0
1 ABIN317896 IHC (p) WB Rabbit Anmelden zum Anzeigen Polyclonal 0
1 ABIN1387732 IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 1
1 ABIN5584259 IHC (p) WB Rabbit pSer345 Anmelden zum Anzeigen Polyclonal 0

General

Antigen Neutrophil Cytosol Factor 1 (NCF1) Antikörper
Reaktivität Human
(251), (107), (93), (15), (14), (11), (11), (7), (5), (1), (1)
Wirt Kaninchen
(226), (42), (1)
Klonalität
Polyklonal
Konjugat Dieser NCF1 Antikörper ist unkonjugiert
(7), (7), (7), (4), (4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(221), (154), (132), (59), (38), (27), (14), (12), (12), (6), (2)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-NCF1 Antikörper

Target Details NCF1 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: YMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENHQ
Isotyp IgG
Plasmids, Primers & others

Target Details NCF1

Produktdetails anti-NCF1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung NCF1 (NCF1 Antibody Abstract)
Hintergrund Gene Symbol: NCF1
Gen-ID 653361
UniProt P14598
Pathways PI3K-Akt Signalweg

Anwendungsinformationen

Produktdetails anti-NCF1 Antikörper Target Details NCF1 Handhabung Bilder zurück nach oben
Applikations-hinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-NCF1 Antikörper Target Details NCF1 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-NCF1 Antikörper Target Details NCF1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Neutrophil Cytosol Factor 1 (NCF1) antibody (ABIN4338258) Immunohistochemistry-Paraffin: NCF1 Antibody [NBP2-33502] - Immunohistochemical stain...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Neutrophil Cytosol Factor 1 (NCF1) antibody (ABIN4338258) Immunohistochemistry-Paraffin: NCF1 Antibody [NBP2-33502] - liver
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Neutrophil Cytosol Factor 1 (NCF1) antibody (ABIN4338258) Immunohistochemistry-Paraffin: NCF1 Antibody [NBP2-33502] - liver cancer
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Neutrophil Cytosol Factor 1 (NCF1) antibody (ABIN4338258) Immunohistochemistry-Paraffin: NCF1 Antibody - Staining of human spleen shows high e...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Neutrophil Cytosol Factor 1 (NCF1) antibody (ABIN4338258) Immunohistochemistry-Paraffin: NCF1 Antibody - Staining in human spleen and cerebral...