anti-Human LAMTOR2 Antikörper für Immunocytochemistry

Recommended LAMTOR2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2 (LAMTOR2) Antikörper
  • ENDAP
  • HSPC003
  • MAPBPIP
  • MAPKSP1AP
  • ROBLD3
  • Ragulator2
  • p14
  • 2010111E04Rik
  • AL022628
  • Mapbpip
  • P14
  • Rab25
  • Robld3
  • robld3
  • zgc:100811
  • mapbpip
  • RGD1562501
  • late endosomal/lysosomal adaptor, MAPK and MTOR activator 2
  • LAMTOR2
  • Lamtor2
  • lamtor2
Reaktivität
Human
38
20
18
Wirt
Kaninchen
38
Klonalität
Polyklonal
Konjugat
Dieser LAMTOR2 Antikörper ist unkonjugiert
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
23
18
17
13
9
5
2
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4350844
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN4350843 ICC IF IHC IHC (p) Rabbit AA 1-125, N-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN3200988 ICC IF IHC (p) Rabbit AA 1-125, N-Term Anmelden zum Anzeigen Polyclonal 0

General

Antigen Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2 (LAMTOR2) Antikörper
Reaktivität Human
(38), (20), (18)
Wirt Kaninchen
(38)
Klonalität
Polyklonal
Konjugat Dieser LAMTOR2 Antikörper ist unkonjugiert
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(23), (18), (17), (13), (9), (5), (2)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-LAMTOR2 Antikörper

Target Details LAMTOR2 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEP
Isotyp IgG

Target Details LAMTOR2

Produktdetails anti-LAMTOR2 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung ROBLD3 (LAMTOR2 Antibody Abstract)
Hintergrund Gene Symbol: LAMTOR2
Gen-ID 28956
Pathways PI3K-Akt Signalweg

Anwendungsinformationen

Produktdetails anti-LAMTOR2 Antikörper Target Details LAMTOR2 Handhabung Bilder zurück nach oben
Applikations-hinweise Western Blot 1:100-1:500, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-LAMTOR2 Antikörper Target Details LAMTOR2 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-LAMTOR2 Antikörper Target Details LAMTOR2 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2 (LAMTOR2) antibody (ABIN4350844) Immunocytochemistry/Immunofluorescence: ROBLD3 Antibody [NBP1-87951] - Staining of hu...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2 (LAMTOR2) antibody (ABIN4350844) Immunohistochemistry-Paraffin: ROBLD3 Antibody [NBP1-87951] - Staining of human stoma...
Western Blotting (WB) image for anti-Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2 (LAMTOR2) antibody (ABIN4350844) Western Blot: ROBLD3 Antibody [NBP1-87951] - Lane 1: Marker [kDa] 250, 130, 95, 72, 5...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2 (LAMTOR2) antibody (ABIN4350844) Immunohistochemistry-Paraffin: ROBLD3 Antibody [NBP1-87951] - Staining of human colon...
Immunofluorescence (IF) image for anti-Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2 (LAMTOR2) antibody (ABIN4350844) Immunocytochemistry/Immunofluorescence: ROBLD3 Antibody - Immunofluorescent staining...