anti-Human GRIA2 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended GRIA2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2) Antikörper
  • GLUR2
  • GluA2
  • GLURB
  • GluR-K2
  • HBGR2
  • GluR2
  • gluR-B
  • glur2
  • GluR-2
  • GluR-B
  • Glur-2
  • Glur2
  • glutamate receptor, ionotropic, AMPA 2
  • glutamate ionotropic receptor AMPA type subunit 2
  • glutamate receptor, ionotropic, AMPA 2 S homeolog
  • glutamate receptor, ionotropic, AMPA2 (alpha 2)
  • GRIA2
  • Gria2
  • gria2.S
Reaktivität
Human
156
129
93
20
19
19
9
7
7
7
4
4
4
3
2
2
1
Wirt
Kaninchen
135
58
Klonalität
Polyklonal
Konjugat
Dieser GRIA2 Antikörper ist unkonjugiert
6
4
3
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
166
60
53
30
25
22
13
8
7
3
3
2
2
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4314579
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
12.4843445 ABIN351533 IHC (p) ELISA WB Mouse IgG2a AA 175-430 Anmelden zum Anzeigen 0
12.4843445 ABIN498651 IF IHC (p) WB Rabbit Anmelden zum Anzeigen Polyclonal 0
1 ABIN3044287 IHC (p) WB Rabbit IgG AA 260-277, Middle Region Anmelden zum Anzeigen Polyclonal 0
1 ABIN447064 ICC IF IHC (p) IHC WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN214049 IHC (p) WB Rabbit IgG pSer880 Anmelden zum Anzeigen Polyclonal 0
1 ABIN302929 IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN2888427 IHC (p) ELISA WB Rabbit IgG pSer880 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2621509 IHC (p) WB Rabbit IgG AA 260-277 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2621510 IHC (p) WB Rabbit IgG AA 25-360 Anmelden zum Anzeigen Polyclonal 0
1 ABIN1735241 IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN800907 IHC (p) WB HRP Rabbit IgG pSer880 Anmelden zum Anzeigen Polyclonal 0
1 ABIN297135 IHC (p) IP WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN2893013 IF IHC (p) WB Rabbit pTyr873 Anmelden zum Anzeigen Polyclonal 0
1 ABIN800900 IHC (p) WB Biotin Rabbit IgG pSer880 Anmelden zum Anzeigen Polyclonal 0
1 ABIN800898 IF (p) IHC (p) WB Rabbit IgG pSer880 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2741174 IHC (p) WB Rabbit pSer880 Anmelden zum Anzeigen Polyclonal 0
1 ABIN3031067 IHC (p) WB Rabbit IgG AA 25-360 Anmelden zum Anzeigen Polyclonal 0
1 ABIN3031066 IHC (p) WB Rabbit IgG Middle Region Anmelden zum Anzeigen Polyclonal 0
1 ABIN5579345 IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN2140469 IHC (p) WB Rabbit IgG Middle Region Anmelden zum Anzeigen Polyclonal 0

General

Antigen Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2) Antikörper
Reaktivität Human
(156), (129), (93), (20), (19), (19), (9), (7), (7), (7), (4), (4), (4), (3), (2), (2), (1)
Wirt Kaninchen
(135), (58)
Klonalität
Polyklonal
Konjugat Dieser GRIA2 Antikörper ist unkonjugiert
(6), (4), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(166), (60), (53), (30), (25), (22), (13), (8), (7), (3), (3), (2), (2), (1), (1), (1)
Pubmed 2 Publikationen vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-GRIA2 Antikörper

Target Details GRIA2 Anwendungsinformationen Handhabung Referenzen für anti-GRIA2 Antikörper (ABIN4314579) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLA
Isotyp IgG

Target Details GRIA2

Produktdetails anti-GRIA2 Antikörper Anwendungsinformationen Handhabung Referenzen für anti-GRIA2 Antikörper (ABIN4314579) Bilder zurück nach oben
Antigen
Andere Bezeichnung GluR2 (GRIA2 Antibody Abstract)
Hintergrund Gene Symbol: GRIA2
Gen-ID 2891
Pathways PI3K-Akt Signalweg

Anwendungsinformationen

Produktdetails anti-GRIA2 Antikörper Target Details GRIA2 Handhabung Referenzen für anti-GRIA2 Antikörper (ABIN4314579) Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-GRIA2 Antikörper Target Details GRIA2 Anwendungsinformationen Referenzen für anti-GRIA2 Antikörper (ABIN4314579) Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen für anti-GRIA2 Antikörper (ABIN4314579)

Produktdetails anti-GRIA2 Antikörper Target Details GRIA2 Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Choi, Choi, Park, Lee, Song, Sung, Song, Kim, Kim, Lee, Kim, Bae, Kim: "Identification of differentially expressed genes according to chemosensitivity in advanced ovarian serous adenocarcinomas: expression of GRIA2 predicts better survival." in: British journal of cancer, Vol. 107, Issue 1, pp. 91-9, 2012

Leja, Essaghir, Essand, Wester, Oberg, Tötterman, Lloyd, Vasmatzis, Demoulin, Giandomenico: "Novel markers for enterochromaffin cells and gastrointestinal neuroendocrine carcinomas." in: Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc, Vol. 22, Issue 2, pp. 261-72, 2009

Bilder

Produktdetails anti-GRIA2 Antikörper Target Details GRIA2 Anwendungsinformationen Handhabung Referenzen für anti-GRIA2 Antikörper (ABIN4314579) zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2) antibody (ABIN4314579) Immunohistochemistry: GluR2 Antibody [NBP1-89765] - Immunohistochemical staining of h...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2) antibody (ABIN4314579) Immunohistochemistry-Paraffin: GluR2 Antibody - Staining of human cerebral cortex sh...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2) antibody (ABIN4314579) Immunohistochemistry-Paraffin: GluR2 Antibody - Staining of human pancreas shows low...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2) antibody (ABIN4314579) Immunohistochemistry-Paraffin: GluR2 Antibody - Staining in human cerebral cortex an...