anti-Ratte (Rattus) Retinoid X Receptor gamma Antikörper für Western Blotting
Recommended Retinoid X Receptor gamma Antibody
- Antigen
-
Retinoid X Receptor, gamma (RXRG) Antikörper
Synonyme für dieses Antigen anzeigen- NR2B3
- RXRC
- zgc:92183
- RXRgamma
- RXRG
- RXR-gamma
- nr2b3
- xrxrg
- rxrc
- Nr2b3
- retinoid X receptor gamma
- retinoid X receptor, gamma b
- retinoid X receptor gamma L homeolog
- RXRG
- rxrgb
- rxrg.L
- rxrg
- Rxrg
- RXRGAMMA
- Epitop
-
N-Term
Alternativen - Reaktivität
-
Human, Maus, Ratte (Rattus)
Alternativen - Wirt
-
Kaninchen
Alternativen - Klonalität
- Konjugat
-
Dieser Retinoid X Receptor gamma Antikörper ist unkonjugiert
Alternativen - Applikation
-
Western Blotting (WB)
Alternativen - Optionen
Produktnummer ABIN630498
$ 449.29
Zzgl. Versandkosten $45.00
Zzgl. Versandkosten $45.00
Relevance Score | ABIN | Application | Konjugat | Host | Isotype | Epitope | Clonality | References | Details |
---|---|---|---|---|---|---|---|---|---|
12.396469 | ABIN2780815 | WB | Rabbit | C-Term | Polyclonal | 2 | |||
10.896469 | ABIN6264890 | ELISA ICC IF WB | Rabbit | IgG | Polyclonal | 0 | |||
9.396469 | ABIN2782291 | WB | Rabbit | N-Term | Polyclonal | 2 | |||
4.8964696 | ABIN2776472 | WB | Rabbit | N-Term | Polyclonal | 1 | |||
4.8964696 | ABIN2461805 | ELISA WB | Rabbit | Polyclonal | 0 | ||||
4.8964696 | ABIN2462870 | ELISA WB | Rabbit | Polyclonal | 0 | ||||
4.8964696 | ABIN2461222 | ELISA WB | Rabbit | Polyclonal | 0 | ||||
4.8964696 | ABIN6568958 | WB | Rabbit | IgG | Polyclonal | 0 | |||
4.8964696 | ABIN5996038 | WB | Rabbit | IgG | Polyclonal | 0 | |||
4.8964696 | ABIN2559797 | ELISA WB | Goat | IgG | Internal Region | Polyclonal | 0 | ||
4.8964696 | ABIN6290901 | WB | Rabbit | IgG | Polyclonal | 0 | |||
4 | ABIN202583 | WB | Rabbit | IgG | AA 67-116 | Polyclonal | 0 | ||
4 | ABIN298198 | ELISA WB | Goat | AA 213-226 | Polyclonal | 0 | |||
4 | ABIN204958 | WB | Rabbit | IgG | C-Term | Polyclonal | 0 | ||
4 | ABIN6736682 | WB | Rabbit | IgG | AA 101-150 | Polyclonal | 0 | ||
4 | ABIN303926 | WB | Mouse | IgG1 | 0 | ||||
1 | ABIN5550822 | WB | Mouse | IgG1 | Hinge Region | 1373 | 0 | ||
1 | ABIN5553012 | WB | Goat | Internal Region | Polyclonal | 0 | |||
1 | ABIN1822913 | IP WB | Rabbit | IgG | N-Term | Polyclonal | 0 | ||
1 | ABIN680932 | IHC (p) WB | HRP | Rabbit | IgG | Polyclonal | 0 |
General |
|
---|---|
Antigen | Retinoid X Receptor, gamma (RXRG) Antikörper |
Epitop | N-Term Alternativen |
Reaktivität | Human, Maus, Ratte (Rattus) Alternativen |
Wirt | Kaninchen Alternativen |
Klonalität | |
Konjugat | Dieser Retinoid X Receptor gamma Antikörper ist unkonjugiert Alternativen |
Applikation |
Western Blotting (WB)
Alternativen
|
Hersteller | |
Produktdetails anti-Retinoid X Receptor gamma AntikörperTarget Details Retinoid X Receptor gamma Anwendungsinformationen Handhabung Bilder |
|
Spezifität | RXRG antibody was raised against the N terminal of RXRG |
Reinigung | Affinity purified |
Immunogen | RXRG antibody was raised using the N terminal of RXRG corresponding to a region with amino acids NVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICAICGDRSSGKH |
Plasmids, Primers & others | |
Target Details Retinoid X Receptor gammaProduktdetails anti-Retinoid X Receptor gamma Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben |
|
Antigen | |
Andere Bezeichnung | RXRG (RXRG Antibody Abstract) |
Hintergrund | RXRG encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. RXRG is expressed at significantly lower levels in non-small cell lung cancer cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
Molekulargewicht | 51 kDa (MW of target protein) |
Pathways | Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway |
AnwendungsinformationenProduktdetails anti-Retinoid X Receptor gamma Antikörper Target Details Retinoid X Receptor gamma Handhabung Bilder zurück nach oben |
|
Applikations-hinweise |
WB: 0.25 µg/mL Optimal conditions should be determined by the investigator. |
Kommentare |
RXRG Blocking Peptide, catalog no. 33R-6930, is also available for use as a blocking control in assays to test for specificity of this RXRG antibody |
Beschränkungen | Nur für Forschungszwecke einsetzbar |
HandhabungProduktdetails anti-Retinoid X Receptor gamma Antikörper Target Details Retinoid X Receptor gamma Anwendungsinformationen Bilder zurück nach oben |
|
Format | Lyophilized |
Rekonstitution | Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RXRG antibody in PBS |
Konzentration | Lot specific |
Buffer | PBS |
Handhabung |
Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use. |
Lagerung | 4 °C |
Informationen zur Lagerung | Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. |