anti-Ratte (Rattus) Retinoid X Receptor gamma Antikörper für Western Blotting

Recommended Retinoid X Receptor gamma Antibody

Retinoid X Receptor, gamma (RXRG) Antikörper
  • NR2B3
  • RXRC
  • zgc:92183
  • RXRgamma
  • RXRG
  • RXR-gamma
  • nr2b3
  • xrxrg
  • rxrc
  • Nr2b3
  • retinoid X receptor gamma
  • retinoid X receptor, gamma b
  • retinoid X receptor gamma L homeolog
  • RXRG
  • rxrgb
  • rxrg.L
  • rxrg
  • Rxrg
Human, Maus, Ratte (Rattus)
Dieser Retinoid X Receptor gamma Antikörper ist unkonjugiert
Western Blotting (WB)
Produktnummer ABIN630498
$ 449.29
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Clonality References Details
12.396469 ABIN2780815 WB Rabbit C-Term Polyclonal 2
10.896469 ABIN6264890 ELISA ICC IF WB Rabbit IgG Polyclonal 0
9.396469 ABIN2782291 WB Rabbit N-Term Polyclonal 2
4.8964696 ABIN2776472 WB Rabbit N-Term Polyclonal 1
4.8964696 ABIN2461805 ELISA WB Rabbit Polyclonal 0
4.8964696 ABIN2462870 ELISA WB Rabbit Polyclonal 0
4.8964696 ABIN2461222 ELISA WB Rabbit Polyclonal 0
4.8964696 ABIN6568958 WB Rabbit IgG Polyclonal 0
4.8964696 ABIN5996038 WB Rabbit IgG Polyclonal 0
4.8964696 ABIN2559797 ELISA WB Goat IgG Internal Region Polyclonal 0
4.8964696 ABIN6290901 WB Rabbit IgG Polyclonal 0
4 ABIN202583 WB Rabbit IgG AA 67-116 Polyclonal 0
4 ABIN298198 ELISA WB Goat AA 213-226 Polyclonal 0
4 ABIN204958 WB Rabbit IgG C-Term Polyclonal 0
4 ABIN6736682 WB Rabbit IgG AA 101-150 Polyclonal 0
4 ABIN303926 WB Mouse IgG1 0
1 ABIN5550822 WB Mouse IgG1 Hinge Region 1373 0
1 ABIN5553012 WB Goat Internal Region Polyclonal 0
1 ABIN1822913 IP WB Rabbit IgG N-Term Polyclonal 0
1 ABIN680932 IHC (p) WB HRP Rabbit IgG Polyclonal 0


Antigen Retinoid X Receptor, gamma (RXRG) Antikörper
Epitop N-Term
(15), (4), (4), (4), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Reaktivität Human, Maus, Ratte (Rattus)
(108), (55), (46), (14), (12), (9), (6), (6), (4), (4), (1), (1), (1), (1), (1), (1)
Wirt Kaninchen
(77), (17), (14)
Konjugat Dieser Retinoid X Receptor gamma Antikörper ist unkonjugiert
(5), (3), (3), (3), (3), (3), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Western Blotting (WB)
(71), (42), (18), (13), (13), (10), (5), (4), (4), (2), (1), (1)

Produktdetails anti-Retinoid X Receptor gamma Antikörper

Target Details Retinoid X Receptor gamma Anwendungsinformationen Handhabung Bilder
Spezifität RXRG antibody was raised against the N terminal of RXRG
Reinigung Affinity purified
Immunogen RXRG antibody was raised using the N terminal of RXRG corresponding to a region with amino acids NVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICAICGDRSSGKH
Plasmids, Primers & others

Target Details Retinoid X Receptor gamma

Produktdetails anti-Retinoid X Receptor gamma Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung RXRG (RXRG Antibody Abstract)
Hintergrund RXRG encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. RXRG is expressed at significantly lower levels in non-small cell lung cancer cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Molekulargewicht 51 kDa (MW of target protein)
Pathways Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway


Produktdetails anti-Retinoid X Receptor gamma Antikörper Target Details Retinoid X Receptor gamma Handhabung Bilder zurück nach oben
Applikations-hinweise WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

RXRG Blocking Peptide, catalog no. 33R-6930, is also available for use as a blocking control in assays to test for specificity of this RXRG antibody

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-Retinoid X Receptor gamma Antikörper Target Details Retinoid X Receptor gamma Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RXRG antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.