anti-Ratte (Rattus) Manic Fringe Antikörper für Western Blotting

Recommended Manic Fringe Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
MFNG Antikörper
  • AW546563
  • MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
  • MFNG
  • Mfng
Epitop
Middle Region
5
4
4
4
4
2
2
2
2
2
1
1
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
56
31
31
6
6
5
5
5
3
2
2
2
1
1
Wirt
Kaninchen
48
10
2
Klonalität
Polyklonal
Konjugat
Dieser Manic Fringe Antikörper ist unkonjugiert
2
2
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
46
18
13
9
6
4
4
3
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN633860
$ 473.93
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
13.252602 ABIN3185449 ELISA WB Rabbit IgG Internal Region Anmelden zum Anzeigen Polyclonal 0
10.803753 ABIN5013233 ICC IHC WB Rabbit IgG AA 56-309 Anmelden zum Anzeigen Polyclonal 0
10.803753 ABIN2909667 IF/ICC IHC IP WB Rabbit AA 56-309 Anmelden zum Anzeigen Polyclonal 0
7.803753 ABIN6258883 ELISA ICC IF WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
7.803753 ABIN1850904 ELISA WB Rabbit Internal Region Anmelden zum Anzeigen Polyclonal 0
4.803753 ABIN2783426 WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal 1
4.803753 ABIN2783425 WB Rabbit Middle Region Anmelden zum Anzeigen Polyclonal 1
4.803753 ABIN2782201 WB Rabbit Middle Region Anmelden zum Anzeigen Polyclonal 0
4.803753 ABIN2463195 ELISA WB Rabbit Anmelden zum Anzeigen Polyclonal 0
4 ABIN1913322 IHC IHC (p) WB Rabbit IgG AA 211-260 Anmelden zum Anzeigen Polyclonal 0
4 ABIN799234 WB Rabbit AA 241-290 Anmelden zum Anzeigen Polyclonal 0
4 ABIN1714395 IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN1451061 ELISA WB Rabbit IgG AA 61-110 Anmelden zum Anzeigen Polyclonal 2
1 ABIN1455903 ELISA WB Rabbit IgG AA 52-101 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2894955 ELISA WB Rabbit IgG AA 52-101 Anmelden zum Anzeigen Polyclonal 0
1 ABIN1711910 IHC (p) WB HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN1700893 IHC (p) WB Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN6104028 ELISA WB Rabbit IgG Internal Region Anmelden zum Anzeigen Polyclonal 0
1 ABIN1577882 ELISA WB Rabbit Anmelden zum Anzeigen Polyclonal 0

General

Antigen MFNG Antikörper
Epitop Middle Region
(5), (4), (4), (4), (4), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Reaktivität Human, Maus, Ratte (Rattus)
(56), (31), (31), (6), (6), (5), (5), (5), (3), (2), (2), (2), (1), (1)
Wirt Kaninchen
(48), (10), (2)
Klonalität
Polyklonal
Konjugat Dieser Manic Fringe Antikörper ist unkonjugiert
(2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Western Blotting (WB)
(46), (18), (13), (9), (6), (4), (4), (3), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-Manic Fringe Antikörper

Target Details Manic Fringe Anwendungsinformationen Handhabung Bilder
Spezifität MFNG antibody was raised against the middle region of MFNG
Reinigung Affinity purified
Immunogen MFNG antibody was raised using the middle region of MFNG corresponding to a region with amino acids MAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETL
Plasmids, Primers & others

Target Details Manic Fringe

Produktdetails anti-Manic Fringe Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung MFNG (MFNG Antibody Abstract)
Hintergrund MFNG is one of the evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. This gene is a member of the fringe gene family which also includes Radical and Lunatic fringe. They all encode evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. While their genomic structure is distinct from other glycosyltransferases, fringe proteins have a fucose-specific beta1,3 N-acetylglucosaminyltransferase activity that leads to elongation of O-linked fucose residues on Notch, which alters Notch signaling.
Molekulargewicht 36 kDa (MW of target protein)
Pathways Notch Signalweg

Anwendungsinformationen

Produktdetails anti-Manic Fringe Antikörper Target Details Manic Fringe Handhabung Bilder zurück nach oben
Applikations-hinweise WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

MFNG Blocking Peptide, catalog no. 33R-5720, is also available for use as a blocking control in assays to test for specificity of this MFNG antibody

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-Manic Fringe Antikörper Target Details Manic Fringe Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFNG antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Bilder

Produktdetails anti-Manic Fringe Antikörper Target Details Manic Fringe Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-MFNG (MFNG) (Middle Region) antibody (ABIN633860) MFNG antibody used at 0.25 ug/ml to detect target protein.