anti-Human Manic Fringe Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended Manic Fringe Antibody (geliefert von: Anmelden zum Anzeigen )

MFNG Antikörper
  • AW546563
  • MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
  • MFNG
  • Mfng
Dieser Manic Fringe Antikörper ist unkonjugiert
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4334059
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
10.879798 ABIN1714395 IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN1913322 IHC IHC (p) WB Rabbit IgG AA 211-260 Anmelden zum Anzeigen Polyclonal 0
1 ABIN1913324 IHC IHC (p) WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN2475483 IHC (p) ELISA Goat IgG Internal Region Anmelden zum Anzeigen Polyclonal 1
1 ABIN1711910 IHC (p) WB HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN1700893 IHC (p) WB Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal 0


Antigen MFNG Antikörper
Reaktivität Human
(58), (33), (33), (6), (6), (6), (5), (5), (3), (2), (2), (2), (1), (1)
Wirt Kaninchen
(49), (10), (2), (1)
Konjugat Dieser Manic Fringe Antikörper ist unkonjugiert
(2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(48), (20), (13), (8), (6), (4), (4), (3), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-Manic Fringe Antikörper

Target Details Manic Fringe Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: TTRAFHRLRLELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCS AEHSHPALSCKMAAEFDTFLAS
Isotyp IgG
Plasmids, Primers & others

Target Details Manic Fringe

Produktdetails anti-Manic Fringe Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung MFNG (MFNG Antibody Abstract)
Hintergrund Gene Symbol: MFNG
Gen-ID 4242
Pathways Notch Signalweg


Produktdetails anti-Manic Fringe Antikörper Target Details Manic Fringe Handhabung Bilder zurück nach oben
Applikations-hinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-Manic Fringe Antikörper Target Details Manic Fringe Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails anti-Manic Fringe Antikörper Target Details Manic Fringe Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-MFNG (MFNG) antibody (ABIN4334059) Immunohistochemistry-Paraffin: MFNG Antibody [NBP2-14234] - Staining of human colon s...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-MFNG (MFNG) antibody (ABIN4334059) Immunohistochemistry-Paraffin: MFNG Antibody - Staining of human colon shows strong ...