anti-Human KCNJ5 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended KCNJ5 Antibody (geliefert von: Anmelden zum Anzeigen )

Potassium Inwardly-Rectifying Channel, Subfamily J, Member 5 (KCNJ5) Antikörper
  • CIR
  • GIRK4
  • KATP1
  • KIR3.4
  • LQT13
  • Kir3.4
  • GIRK-4
  • KATP-1
  • potassium voltage-gated channel subfamily J member 5
  • potassium inwardly-rectifying channel, subfamily J, member 5
  • KCNJ5
  • Kcnj5
Dieser KCNJ5 Antikörper ist unkonjugiert
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4329042
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
12.389673 ABIN4329043 IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN1423384 IHC (p) WB HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN1405513 IHC (p) WB Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN1387227 IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN5581637 IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN5581636 IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0


Antigen Potassium Inwardly-Rectifying Channel, Subfamily J, Member 5 (KCNJ5) Antikörper
Reaktivität Human
(63), (30), (30), (4), (2), (2), (1), (1), (1), (1), (1)
Wirt Kaninchen
(60), (5)
Konjugat Dieser KCNJ5 Antikörper ist unkonjugiert
(3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(50), (22), (13), (8), (6), (6), (5), (4), (1), (1)
Pubmed 2 Publikationen vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-KCNJ5 Antikörper

Target Details KCNJ5 Anwendungsinformationen Handhabung Referenzen für anti-KCNJ5 Antikörper (ABIN4329042) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQRYMEKSGKCNVHHGNVQETY
Isotyp IgG
Plasmids, Primers & others

Target Details KCNJ5

Produktdetails anti-KCNJ5 Antikörper Anwendungsinformationen Handhabung Referenzen für anti-KCNJ5 Antikörper (ABIN4329042) Bilder zurück nach oben
Andere Bezeichnung Kir3.4 (KCNJ5 Antibody Abstract)
Hintergrund Gene Symbol: KCNJ5
Gen-ID 3762
Pathways Notch Signalweg


Produktdetails anti-KCNJ5 Antikörper Target Details KCNJ5 Handhabung Referenzen für anti-KCNJ5 Antikörper (ABIN4329042) Bilder zurück nach oben
Applikations-hinweise Western Blot 1:100-1:500, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-KCNJ5 Antikörper Target Details KCNJ5 Anwendungsinformationen Referenzen für anti-KCNJ5 Antikörper (ABIN4329042) Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen für anti-KCNJ5 Antikörper (ABIN4329042)

Produktdetails anti-KCNJ5 Antikörper Target Details KCNJ5 Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Zhou, Shaikh, Neogi, McFarlane, Zhao, Figg, Brighton, Maniero, Teo, Azizan, Brown: "DACH1, a zona glomerulosa selective gene in the human adrenal, activates transforming growth factor-β signaling and suppresses aldosterone secretion." in: Hypertension (Dallas, Tex. : 1979), Vol. 65, Issue 5, pp. 1103-10, 2015 (Probematerial (Species): Human). Weitere Details: Immunohistochemistry

Azizan, Poulsen, Tuluc, Zhou, Clausen, Lieb, Maniero, Garg, Bochukova, Zhao, Shaikh, Brighton, Teo, Davenport, Dekkers, Tops, Küsters, Ceral, Yeo, Neogi, McFarlane, Rosenfeld, Marass, Hadfield et al.: "Somatic mutations in ATP1A1 and CACNA1D underlie a common subtype of adrenal hypertension. ..." in: Nature genetics, Vol. 45, Issue 9, pp. 1055-60, 2013


Produktdetails anti-KCNJ5 Antikörper Target Details KCNJ5 Anwendungsinformationen Handhabung Referenzen für anti-KCNJ5 Antikörper (ABIN4329042) zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Potassium Inwardly-Rectifying Channel, Subfamily J, Member 5 (KCNJ5) antibody (ABIN4329042) Western Blot: Kir3.4 Antibody [NBP1-88081] - Lane 1: Marker [kDa] 250, 130, 95, 72, 5...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Potassium Inwardly-Rectifying Channel, Subfamily J, Member 5 (KCNJ5) antibody (ABIN4329042) Immunohistochemistry-Paraffin: Kir3.4 Antibody [NBP1-88081] - Staining of human pancr...
Western Blotting (WB) image for anti-Potassium Inwardly-Rectifying Channel, Subfamily J, Member 5 (KCNJ5) antibody (ABIN4329042) Western Blot: Kir3.4 Antibody - Analysis in control (vector only transfected HEK293T...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Potassium Inwardly-Rectifying Channel, Subfamily J, Member 5 (KCNJ5) antibody (ABIN4329042) Immunohistochemistry-Paraffin: Kir3.4 Antibody - Staining in human adrenal gland and...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Potassium Inwardly-Rectifying Channel, Subfamily J, Member 5 (KCNJ5) antibody (ABIN4329042) Immunohistochemistry-Paraffin: Kir3.4 Antibody - Staining of human cerebral cortex s...
Immunohistochemistry (IHC) image for anti-Potassium Inwardly-Rectifying Channel, Subfamily J, Member 5 (KCNJ5) antibody (ABIN4329042) Immunohistochemistry: Kir3.4 Antibody - Staining of human adrenal gland shows high e...