anti-Human Growth Hormone 2 Antikörper für Western Blotting

Recommended Growth Hormone 2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Growth Hormone 2 (GH2) Antikörper
  • GH-V
  • GHL
  • GHV
  • hGH-V
  • growth hormone 2
  • GH2
Epitop
Middle Region
10
10
10
8
3
2
1
1
1
Reaktivität
Human
63
9
8
2
2
2
2
2
2
1
1
Wirt
Kaninchen
57
6
Klonalität
Polyklonal
Konjugat
Dieser Growth Hormone 2 Antikörper ist unkonjugiert
4
4
4
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
48
33
13
10
3
2
2
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN634800
$ 473.93
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
16.562979 ABIN630286 WB Rabbit Middle Region Anmelden zum Anzeigen Polyclonal 0
12.760654 ABIN2142508 ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
10.802324 ABIN2430173 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
10.802324 ABIN2423531 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
7.8023243 ABIN2775499 WB Rabbit Middle Region Anmelden zum Anzeigen Polyclonal 0
7.8023243 ABIN1868144 ICC IHC WB Rabbit IgG AA 27-217 Anmelden zum Anzeigen Polyclonal 0
7.8023243 ABIN2931766 IF/ICC IHC IP WB Rabbit AA 27-217 Anmelden zum Anzeigen Polyclonal 0
7 ABIN561040 ELISA WB Mouse IgG1 kappa AA 27-217, full length Anmelden zum Anzeigen 1D10 0
7 ABIN561039 ELISA WB Mouse IgG1 kappa AA 27-217, full length Anmelden zum Anzeigen 1E11 0
4.8023243 ABIN2773796 WB Rabbit Middle Region Anmelden zum Anzeigen Polyclonal 1
4.8023243 ABIN952634 EIA WB Rabbit Ig Fraction N-Term, AA 18-45 Anmelden zum Anzeigen Polyclonal 5
4.8023243 ABIN1539129 WB Rabbit Ig AA 19-45, N-Term Anmelden zum Anzeigen Polyclonal 0
4.8023243 ABIN2462514 ELISA WB Rabbit Anmelden zum Anzeigen Polyclonal 0
4 ABIN468793 WB Rabbit AA 143-192 Anmelden zum Anzeigen Polyclonal 0
4 ABIN204981 WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal 0
4 ABIN5531310 WB Rabbit Ig Fraction AA 19-45, N-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN2273718 ELISA WB Rabbit IgG N-Term, AA 18-45 Anmelden zum Anzeigen Polyclonal 0
1 ABIN1898424 ELISA WB FITC Rabbit IgG AA 19-45 Anmelden zum Anzeigen Polyclonal 0
1 ABIN1898421 ELISA WB Alkaline Phosphatase (AP) Rabbit IgG AA 19-45 Anmelden zum Anzeigen Polyclonal 0
1 ABIN1898425 ELISA WB PE Rabbit IgG AA 19-45 Anmelden zum Anzeigen Polyclonal 0

General

Antigen Growth Hormone 2 (GH2) Antikörper
Epitop Middle Region
(10), (10), (10), (8), (3), (2), (1), (1), (1)
Reaktivität Human
(63), (9), (8), (2), (2), (2), (2), (2), (2), (1), (1)
Wirt Kaninchen
(57), (6)
Klonalität
Polyklonal
Konjugat Dieser Growth Hormone 2 Antikörper ist unkonjugiert
(4), (4), (4), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Western Blotting (WB)
(48), (33), (13), (10), (3), (2), (2), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-Growth Hormone 2 Antikörper

Target Details Growth Hormone 2 Anwendungsinformationen Handhabung Bilder
Spezifität Growth Hormone 2 antibody was raised against the middle region of GH2
Reinigung Affinity purified
Immunogen Growth Hormone 2 antibody was raised using the middle region of GH2 corresponding to a region with amino acids LEEGIQTLIGWKMAAPGLGRSSISPTASLTQNRTTMTHCSRTTGCSTASG
Plasmids, Primers & others

Target Details Growth Hormone 2

Produktdetails anti-Growth Hormone 2 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung Growth Hormone 2 (GH2 Antibody Abstract)
Substanzklasse Hormone
Hintergrund GH2 is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. Mutations in its gene lead to placental growth hormone/lactogen deficiency.
Molekulargewicht 27 kDa (MW of target protein)
Pathways NF-kappaB Signalweg, JAK-STAT Signalweg, Response to Growth Hormone Stimulus

Anwendungsinformationen

Produktdetails anti-Growth Hormone 2 Antikörper Target Details Growth Hormone 2 Handhabung Bilder zurück nach oben
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

Growth Hormone 2 Blocking Peptide, catalog no. 33R-4888, is also available for use as a blocking control in assays to test for specificity of this Growth Hormone 2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-Growth Hormone 2 Antikörper Target Details Growth Hormone 2 Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GH2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Bilder

Produktdetails anti-Growth Hormone 2 Antikörper Target Details Growth Hormone 2 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Growth Hormone 2 (GH2) (Middle Region) antibody (ABIN634800) Growth Hormone 2 antibody used at 1 ug/ml to detect target protein.