anti-Human RAD1 Antikörper für Immunocytochemistry

Recommended RAD1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
RAD1 Homolog (S. Pombe) (RAD1) Antikörper
  • HRAD1
  • REC1
  • zgc:56502
  • zgc:77779
  • RAD1
  • xrad1
  • DKFZp459H1127
  • RAD1 checkpoint DNA exonuclease
  • RAD1 homolog (S. pombe)
  • RAD1
  • Rad1
  • rad1
Reaktivität
Human
94
25
12
2
2
2
2
2
1
1
1
1
Wirt
Kaninchen
56
38
7
Klonalität
Polyklonal
Konjugat
Dieser RAD1 Antikörper ist unkonjugiert
5
5
4
4
4
4
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
97
38
18
7
6
1
1
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4349062
Preis und Verfügbarkeit auf Anfrage.

General

Antigen RAD1 Homolog (S. Pombe) (RAD1) Antikörper
Reaktivität Human
(94), (25), (12), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Wirt Kaninchen
(56), (38), (7)
Klonalität
Polyklonal
Konjugat Dieser RAD1 Antikörper ist unkonjugiert
(5), (5), (4), (4), (4), (4), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(97), (38), (18), (7), (6), (1), (1), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-RAD1 Antikörper

Target Details RAD1 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: GLREAFSELDMTSEVLQITMSPDKPYFRLSTFGNAGSSHLDYPKDSDLME AFHCNQTQVNRYKISLLKPSTKALVLSCKVSIRTDNRGFLSLQYMIRNED GQICFVEYYCCPDEEVPESES
Isotyp IgG

Target Details RAD1

Produktdetails anti-RAD1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung Rad1 (RAD1 Antibody Abstract)
Hintergrund Gene Symbol: RAD1
Gen-ID 5810
Pathways M Phase

Anwendungsinformationen

Produktdetails anti-RAD1 Antikörper Target Details RAD1 Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200Immunohistochemistry retrieval recommended: HIER pH 6, Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-RAD1 Antikörper Target Details RAD1 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-RAD1 Antikörper Target Details RAD1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-RAD1 Homolog (S. Pombe) (RAD1) antibody (ABIN4349062) Immunohistochemistry-Paraffin: Rad1 Antibody [NBP2-13196] - Staining of human lymph n...
Immunofluorescence (IF) image for anti-RAD1 Homolog (S. Pombe) (RAD1) antibody (ABIN4349062) Immunocytochemistry/Immunofluorescence: Rad1 Antibody [NBP2-13196] - Staining of huma...
Western Blotting (WB) image for anti-RAD1 Homolog (S. Pombe) (RAD1) antibody (ABIN4349062) Western Blot: Rad1 Antibody [NBP2-13196] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56,...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-RAD1 Homolog (S. Pombe) (RAD1) antibody (ABIN4349062) Immunohistochemistry-Paraffin: Rad1 Antibody - Staining of human urinary bladder sho...