anti-Maus Optineurin Antikörper für Immunohistochemistry (Paraffin-embedded Sections)
Recommended Optineurin Antibody (geliefert von: Anmelden zum Anzeigen )
- Antigen
-
Optineurin (OPTN) Antikörper
Synonyme für dieses Antigen anzeigen- nrp
- fip2
- hip7
- hypl
- glc1e
- tfiiia-intp
- ALS12
- FIP2
- GLC1E
- HIP7
- HYPL
- NRP
- TFIIIA-INTP
- Fip2
- 4930441O07Rik
- fj52f04
- si:ch211-240l19.3
- wu:fj52f04
- zgc:66386
- zgc:77868
- optineurin
- optineurin L homeolog
- OPTN
- optn
- Optn
- optn.L
- Reaktivität
-
Human, Maus
Alternativen - Wirt
-
Kaninchen
Alternativen - Klonalität
- Konjugat
-
Unkonjugiert
Alternativen - Applikation
-
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Alternativen - Hersteller
- Anmelden zum Anzeigen
- Hersteller Produkt- Nr.
- Anmelden zum Anzeigen
Produkt kostenlos erhalten?
Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren
Bilder
Produktnummer ABIN4341482
Preis und Verfügbarkeit auf Anfrage.
| Relevance Score | ABIN | Application | Konjugat | Host | Isotype | Epitope | Hersteller | Clonality | References | Details |
|---|---|---|---|---|---|---|---|---|---|---|
| 12.839581 | ABIN2178063 | IF (p) IHC (p) | Rabbit | IgG | Anmelden zum Anzeigen | Polyclonal | 0 | |||
| 1 | ABIN5611418 | IHC (p) WB | Rabbit | IgG | AA 115-130 | Anmelden zum Anzeigen | Polyclonal | 0 | ||
| 1 | ABIN1737662 | IHC (p) WB | Rabbit | IgG | AA 575-591 | Anmelden zum Anzeigen | Polyclonal | 0 | ||
| 1 | ABIN2178074 | IHC (p) | HRP | Rabbit | IgG | Anmelden zum Anzeigen | Polyclonal | 0 | ||
| 1 | ABIN2451620 | IHC (p) WB | Rabbit | IgG | AA 575-591 | Anmelden zum Anzeigen | Polyclonal | 0 | ||
| 1 | ABIN2178068 | IHC (p) | Biotin | Rabbit | IgG | Anmelden zum Anzeigen | Polyclonal | 0 | ||
| 1 | ABIN5554063 | IHC (p) WB | Rabbit | AA 575-591 | Anmelden zum Anzeigen | Polyclonal | 0 | |||
| 1 | ABIN2727923 | EIA ICC IF IHC (p) WB | Rabbit | IgG | Anmelden zum Anzeigen | Polyclonal | 0 |
General |
|
|---|---|
| Antigen | Optineurin (OPTN) Antikörper |
| Reaktivität | Human, Maus Alternativen |
| Wirt | Kaninchen Alternativen |
| Klonalität | |
| Konjugat | Unkonjugiert Alternativen |
| Applikation |
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Alternativen
|
|
1 Publikation vorhanden |
| Hersteller | Anmelden zum Anzeigen |
ProduktdetailsAntigendetails Anwendungsinformationen Handhabung Referenzen Bilder |
|
| Spezifität | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Reinigung | Immunogen affinity purified |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:LGIVSELQLKLNSSGSSEDSFVEIRMAEGEAEGSVKEIKHSPGPTRTVSTGTALSKYRSRSADGAKNYFEHEELTVSQLLLCLREGNQKVERLEVALKEAKERVSDFEKKTSNRSEIETQTEGSTEKENDEEKG |
| Isotyp | IgG |
AntigendetailsProduktdetails Anwendungsinformationen Handhabung Referenzen Bilder zurück nach oben |
|
| Antigen | |
| Andere Bezeichnung | Optineurin (OPTN Antibody Abstract) |
| Hintergrund | Gene Symbol: OPTN |
| Gen-ID | 10133 |
| Pathways | M Phase |
AnwendungsinformationenProduktdetails Antigendetails Handhabung Referenzen Bilder zurück nach oben |
|
| Applikationshinweise | Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500, Immunohistochemistry-Frozen 1:10-1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100. Frozen sections done on mouse retina from customer review. |
| Kommentare |
The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo. |
| Beschränkungen | Nur für Forschungszwecke einsetzbar |
HandhabungProduktdetails Antigendetails Anwendungsinformationen Referenzen Bilder zurück nach oben |
|
| Format | Liquid |
| Buffer |
PBS ( pH 7.2) and 40 % Glycerol Buffer contains: 0.02 % Sodium Azide |
| Konservierungsmittel | Sodium azide |
| Vorsichtsmaßnahmen | This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Lagerung | 4 °C,-20 °C |
| Informationen zur Lagerung | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
ReferenzenProduktdetails Antigendetails Anwendungsinformationen Handhabung Bilder zurück nach oben |
|
| Produkt verwendet in: |
Smith, Sewell, Levine, Chew, Dunne, OShea, Smith, Harrison, Macdonald, Bloom, Segal: "Disruption of macrophage pro-inflammatory cytokine release in Crohn's disease is associated with reduced optineurin expression in a subset of patients." in: Immunology, Vol. 144, Issue 1, pp. 45-55, 2014 (Probematerial (Species): Human). Weitere Details: Western Blotting |
BilderProduktdetails Antigendetails Anwendungsinformationen Handhabung Referenzen zurück nach oben |
|
| Bilder des Herstellers |
Immunocytochemistry/Immunofluorescence: Optineurin Antibody [NBP1-84682] - Staining o...
Western Blot: Optineurin Antibody [NBP1-84682] - Lane 1: Marker [kDa] 220, 112, 84, 4...
Immunohistochemistry-Paraffin: Optineurin Antibody [NBP1-84682] - Staining of human o...
Immunohistochemistry-Frozen: Optineurin Antibody [NBP1-84682] - Image and review of O...
Western Blot: Optineurin Antibody - Analysis in human cell line HDLM-2.
Immunohistochemistry-Paraffin: Optineurin Antibody - Staining of human pancreas show...
Immunohistochemistry-Paraffin: Optineurin Antibody - Staining of human cerebral cort...
Immunohistochemistry-Paraffin: Optineurin Antibody - Staining of human skin shows mo...
Immunohistochemistry-Paraffin: Optineurin Antibody - Staining of human placenta show...
Immunohistochemistry-Paraffin: Optineurin Antibody - Staining in human cerebral cort...
|
