anti-Human CKAP5 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended CKAP5 Antibody (geliefert von: Anmelden zum Anzeigen )

Cytoskeleton Associated Protein 5 (CKAP5) Antikörper
  • ckap5
  • tog
  • msps
  • togp
  • ckap5b
  • xmap215
  • CKAP5
  • im:7143385
  • wu:fb14c01
  • wu:fb59e03
  • wu:fi33f02
  • zgc:123012
  • MSPS
  • TOG
  • TOGp
  • ch-TOG
  • 3110043H24Rik
  • 4930432B04Rik
  • D730027C18Rik
  • T25636
  • mKIAA0097
  • cytoskeleton associated protein 5
  • cytoskeleton associated protein 5 S homeolog
  • cytoskeleton-associated protein 5
  • ckap5
  • ckap5.S
  • CKAP5
  • LOC100548902
  • Ckap5
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4297843
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN4297844 ICC IF IHC IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN714011 IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN5575534 IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN5575533 IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal 0


Antigen Cytoskeleton Associated Protein 5 (CKAP5) Antikörper
Reaktivität Human
(23), (13), (10), (4), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Wirt Kaninchen
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(20), (11), (9), (4), (2), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-CKAP5 Antikörper

Target Details CKAP5 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MSSKLNQARSMSGHPEAAQMVRREFQLDLDEIENDNGTVRCEMPELVQHKLDDIFEPVLIPEPKIRAVSPHFDDMHSNTASTINFI
Isotyp IgG

Target Details CKAP5

Produktdetails anti-CKAP5 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung Ch-TOG (CKAP5 Antibody Abstract)
Hintergrund Gene Symbol: CKAP5
Gen-ID 9793
Pathways M Phase


Produktdetails anti-CKAP5 Antikörper Target Details CKAP5 Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500For HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-CKAP5 Antikörper Target Details CKAP5 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails anti-CKAP5 Antikörper Target Details CKAP5 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Cytoskeleton Associated Protein 5 (CKAP5) antibody (ABIN4297843) Immunocytochemistry/Immunofluorescence: ch-TOG Antibody [NBP1-85624] - Immunofluoresc...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Cytoskeleton Associated Protein 5 (CKAP5) antibody (ABIN4297843) Immunohistochemistry-Paraffin: ch-TOG Antibody [NBP1-85624] - Staining of human cereb...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Cytoskeleton Associated Protein 5 (CKAP5) antibody (ABIN4297843) Immunohistochemistry-Paraffin: ch-TOG Antibody - Staining of human cerebral cortex s...
Immunofluorescence (fixed cells) (IF/ICC) image for anti-Cytoskeleton Associated Protein 5 (CKAP5) antibody (ABIN4297843) Immunocytochemistry/Immunofluorescence: ch-TOG Antibody - Staining of human cell lin...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Cytoskeleton Associated Protein 5 (CKAP5) antibody (ABIN4297843) Immunohistochemistry-Paraffin: ch-TOG Antibody - Staining of human pancreas shows lo...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Cytoskeleton Associated Protein 5 (CKAP5) antibody (ABIN4297843) Immunohistochemistry-Paraffin: ch-TOG Antibody - Staining of human testis shows high...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Cytoskeleton Associated Protein 5 (CKAP5) antibody (ABIN4297843) Immunohistochemistry-Paraffin: ch-TOG Antibody - Staining in human testis and pancre...