anti-Human CEP57 Antikörper für Immunofluorescence

Recommended CEP57 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Centrosomal Protein 57kDa (CEP57) Antikörper
  • 3110002L15RIK
  • CEP57
  • cep57r
  • xCep57
  • c6orf182
  • 3110002l15rik
  • RGD1309884
  • 3110002L15Rik
  • 4921510P06Rik
  • 4931428M20Rik
  • AI467480
  • Tsp57
  • mKIAA0092
  • MVA2
  • PIG8
  • TSP57
  • centrosomal protein 57
  • centrosomal protein 57kDa-like 1
  • CEP57
  • cep57l1
  • Cep57
Reaktivität
Human
67
17
15
3
Wirt
Kaninchen
61
6
Klonalität
Polyklonal
Konjugat
Dieser CEP57 Antikörper ist unkonjugiert
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
52
27
13
9
6
5
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4297744
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
11.745464 ABIN523180 IF WB Mouse AA 1-500, full length Anmelden zum Anzeigen Polyclonal 0
1 ABIN2575637 IF ELISA WB Mouse IgG1, kappa AA 19-128 Anmelden zum Anzeigen 0
1 ABIN2575636 IF WB Mouse IgG AA 1-500 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2232000 IF WB Mouse IgG AA 1-500 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2866328 IF ELISA WB Mouse IgG1 kappa AA 19-128 Anmelden zum Anzeigen 1E9 0

General

Antigen Centrosomal Protein 57kDa (CEP57) Antikörper
Reaktivität Human
(67), (17), (15), (3)
Wirt Kaninchen
(61), (6)
Klonalität
Polyklonal
Konjugat Dieser CEP57 Antikörper ist unkonjugiert
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(52), (27), (13), (9), (6), (5), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-CEP57 Antikörper

Target Details CEP57 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SKNEESKHNQELTSQLLAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERKR
Isotyp IgG

Target Details CEP57

Produktdetails anti-CEP57 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung CEP57 (CEP57 Antibody Abstract)
Hintergrund Gene Symbol: CEP57
Gen-ID 9702
Pathways M Phase, Maintenance of Protein Location, Protein targeting to Nucleus, Growth Factor Binding

Anwendungsinformationen

Produktdetails anti-CEP57 Antikörper Target Details CEP57 Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-CEP57 Antikörper Target Details CEP57 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-CEP57 Antikörper Target Details CEP57 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Centrosomal Protein 57kDa (CEP57) antibody (ABIN4297744) Immunocytochemistry/Immunofluorescence: CEP57 Antibody [NBP1-83045] - Staining of hum...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Centrosomal Protein 57kDa (CEP57) antibody (ABIN4297744) Immunohistochemistry-Paraffin: CEP57 Antibody [NBP1-83045] - Immunohistochemical stai...
Western Blotting (WB) image for anti-Centrosomal Protein 57kDa (CEP57) antibody (ABIN4297744) Western Blot: CEP57 Antibody [NBP1-83045] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Centrosomal Protein 57kDa (CEP57) antibody (ABIN4297744) Immunohistochemistry-Paraffin: CEP57 Antibody - Staining of human urinary bladder sh...