anti-Human C9 Antikörper für Immunocytochemistry

Recommended C9 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Complement Component C9 (C9) Antikörper
  • LOC100037951
  • LOC100136130
  • c9
  • wu:fb60b05
  • wu:fd50e04
  • zgc:112272
  • complement C9
  • complement component 9
  • complement component 9 L homeolog
  • C9
  • c9
  • c9.L
Reaktivität
Human
104
18
14
2
Wirt
Kaninchen
57
41
6
2
1
1
Klonalität
Polyklonal
Konjugat
Dieser C9 Antikörper ist unkonjugiert
5
5
5
4
4
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
79
59
37
23
16
8
7
3
2
2
2
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4299957
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN1866979 ICC IHC WB Rabbit IgG AA 22-265 Anmelden zum Anzeigen Polyclonal 0
1 ABIN4299959 ICC IF WB Rabbit IgG Center Anmelden zum Anzeigen Polyclonal 1
1 ABIN1732510 ICC IF IHC (p) WB Rabbit IgG AA 184-411 Anmelden zum Anzeigen Polyclonal 0
1 ABIN5694048 FACS IA ICC IF IHC (fro) IHC (p) WB Human IgG1 Anmelden zum Anzeigen WU13-15 0
1 ABIN2467264 ICC IF IHC WB Rabbit AA 184-411 Anmelden zum Anzeigen Polyclonal 0

General

Antigen Complement Component C9 (C9) Antikörper
Reaktivität Human
(104), (18), (14), (2)
Wirt Kaninchen
(57), (41), (6), (2), (1), (1)
Klonalität
Polyklonal
Konjugat Dieser C9 Antikörper ist unkonjugiert
(5), (5), (5), (4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(79), (59), (37), (23), (16), (8), (7), (3), (2), (2), (2), (1), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-C9 Antikörper

Target Details C9 Anwendungsinformationen Handhabung Referenzen für anti-C9 Antikörper (ABIN4299957) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:CLGYHLDVSLAFSEISVGAEFNKDDCVKRGEGRAVNITSENLIDDVVSLIRGGTRKYAFELKEKLLRGTVIDVTDFVNWASSINDAPVLISQKLSPIYNLVPVKMKNAHLKKQNLERAIEDYINEFSVRKCHTCQNGGTVILMDGK
Isotyp IgG

Target Details C9

Produktdetails anti-C9 Antikörper Anwendungsinformationen Handhabung Referenzen für anti-C9 Antikörper (ABIN4299957) Bilder zurück nach oben
Antigen
Andere Bezeichnung Complement Component C9 (C9 Antibody Abstract)
Hintergrund Gene Symbol: C9
Gen-ID 735
Pathways Komplementsystem

Anwendungsinformationen

Produktdetails anti-C9 Antikörper Target Details C9 Handhabung Referenzen für anti-C9 Antikörper (ABIN4299957) Bilder zurück nach oben
Applikations-hinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:2500 - 1:5000, ImmunofluorescenceFor IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-C9 Antikörper Target Details C9 Anwendungsinformationen Referenzen für anti-C9 Antikörper (ABIN4299957) Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen für anti-C9 Antikörper (ABIN4299957)

Produktdetails anti-C9 Antikörper Target Details C9 Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Neiman, Fredolini, Johansson, Lehtiö, Nygren, Uhlén, Nilsson, Schwenk: "Selectivity analysis of single binder assays used in plasma protein profiling." in: Proteomics, Vol. 13, Issue 23-24, pp. 3406-10, 2013

Bilder

Produktdetails anti-C9 Antikörper Target Details C9 Anwendungsinformationen Handhabung Referenzen für anti-C9 Antikörper (ABIN4299957) zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Complement Component C9 (C9) antibody (ABIN4299957) Immunofluorescence: Complement Component C9 Antibody [NBP1-87440] - Staining of human...
Immunohistochemistry (IHC) image for anti-Complement Component C9 (C9) antibody (ABIN4299957) Immunohistochemistry: Complement Component C9 Antibody [NBP1-87440] - Staining of hum...