anti-Human LIFR Antikörper für Western Blotting

Recommended LIFR Antibody (geliefert von: Anmelden zum Anzeigen )

Leukemia Inhibitory Factor Receptor alpha (LIFR) Antikörper
  • A230075M04Rik
  • AW061234
  • LIF
  • CD118
  • LIF-R
  • SJS2
  • STWS
  • SWS
  • leukemia inhibitory factor receptor
  • LIF receptor alpha
  • leukemia inhibitory factor receptor alpha
  • Lifr
  • LOC397451
  • LIFR
AA 863-899, C-Term
Dieser LIFR Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN3043410
$ 240.00
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
3.3325143 ABIN3181444 ELISA WB Rabbit IgG Internal Region Anmelden zum Anzeigen Polyclonal
3.3325143 ABIN1859660 ICC IHC IP WB Rabbit IgG AA 522-691 Anmelden zum Anzeigen Polyclonal
3.3325143 ABIN1859655 ICC IHC IP WB Rabbit IgG AA 692-833 Anmelden zum Anzeigen Polyclonal
3.3325143 ABIN1173141 ICC IHC IP WB Rabbit IgG AA 45-184 Anmelden zum Anzeigen Polyclonal
3.3325143 ABIN3028798 ELISA WB Rabbit Ig Fraction AA 1021-1055, C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN686827 FACS IF (p) IHC (p) WB Rabbit IgG AA 500-550 Anmelden zum Anzeigen Polyclonal 1
1 ABIN4900352 CyTOF FACS WB Mouse IgG1 AA 45-833 Anmelden zum Anzeigen 32953 1
1 ABIN2737110 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5633895 ELISA WB Rabbit IgG AA 731-780 Anmelden zum Anzeigen Polyclonal
1 ABIN561669 ELISA WB Mouse AA 45-154, partial Anmelden zum Anzeigen Polyclonal
1 ABIN2618334 ELISA WB Biotin Rabbit IgG AA 522-691 Anmelden zum Anzeigen Polyclonal
1 ABIN2592685 ELISA WB FITC Rabbit IgG AA 522-691 Anmelden zum Anzeigen Polyclonal
1 ABIN2592688 ELISA WB FITC Rabbit IgG AA 692-833 Anmelden zum Anzeigen Polyclonal
1 ABIN2592686 ELISA WB FITC Rabbit IgG AA 45-184 Anmelden zum Anzeigen Polyclonal
1 ABIN2618335 ELISA WB Biotin Rabbit IgG AA 692-833 Anmelden zum Anzeigen Polyclonal
1 ABIN2592680 ELISA WB Biotin Rabbit IgG AA 522-691 Anmelden zum Anzeigen Polyclonal
1 ABIN1977440 WB Rabbit AA 1047-1097 Anmelden zum Anzeigen Polyclonal
1 ABIN2592677 ELISA WB Rabbit IgG AA 45-184 Anmelden zum Anzeigen Polyclonal
1 ABIN2592671 ELISA WB Rabbit IgG AA 522-691 Anmelden zum Anzeigen Polyclonal
1 ABIN2592673 ELISA WB Rabbit IgG AA 692-833 Anmelden zum Anzeigen Polyclonal


Antigen Leukemia Inhibitory Factor Receptor alpha (LIFR) Antikörper
Epitop AA 863-899, C-Term
(6), (6), (5), (5), (5), (5), (5), (5), (5), (4), (3), (3), (3), (3), (3), (2), (2), (1), (1), (1), (1), (1), (1)
Reaktivität Human
(47), (36), (23), (1), (1), (1), (1), (1)
Wirt Kaninchen
(68), (18), (10)
Konjugat Dieser LIFR Antikörper ist unkonjugiert
(12), (9), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Applikation Western Blotting (WB)
(60), (60), (27), (21), (9), (9), (9), (3), (2), (2), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-LIFR Antikörper

Target Details LIFR Anwendungsinformationen Handhabung Bilder
Verwendungszweck Rabbit IgG polyclonal antibody for Leukemia inhibitory factor receptor(LIFR) detection. Tested with WB in Human.
Kreuzreaktivität (Details) No cross reactivity with other proteins.
Produktmerkmale Rabbit IgG polyclonal antibody for Leukemia inhibitory factor receptor(LIFR) detection. Tested with WB in Human.
Gene Name: leukemia inhibitory factor receptor alpha
Protein Name: Leukemia inhibitory factor receptor
Reinigung Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human LIFR(863-899aa EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE), different from the related mouse and rat sequences by one amino acid.
Isotyp IgG

Target Details LIFR

Produktdetails anti-LIFR Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung LIFR (LIFR Antibody Abstract)
Hintergrund LIFR also known as CD118 (Cluster of Differentiation 118), is a subunit of a receptor for leukemia inhibitory factor. This gene encodes a protein that belongs to the type I cytokine receptor family. This protein combines with a high-affinity converter subunit, gp130, to form a receptor complex that mediates the action of the leukemia inhibitory factor, a polyfunctional cytokine that is involved in cellular differentiation, proliferation and survival in the adult and the embryo. Mutations in this gene cause Schwartz-Jampel syndrome type 2, a disease belonging to the group of the bent-bone dysplasias. A translocation that involves the promoter of this gene, t(5,8)(p13,q12) with the pleiomorphic adenoma gene 1, is associated with salivary gland pleiomorphic adenoma, a common type of benign epithelial tumor of the salivary gland. Multiple splice variants encoding the same protein have been found for this gene.

Synonyms: CD118 antibody|CD118 antigen antibody|FLJ98106 antibody|FLJ99923 antibody|Leukemia inhibitory factor receptor alpha antibody|Leukemia inhibitory factor receptor antibody|LIF R antibody|LIF receptor antibody|LIF-R antibody|Lifr antibody|LIFR_HUMAN antibody|SJS2 antibody|STWS antibody|SWS antibody
Gen-ID 3977
UniProt P42702
Pathways JAK-STAT Signalweg, Growth Factor Binding


Produktdetails anti-LIFR Antikörper Target Details LIFR Handhabung Bilder zurück nach oben
Applikationshinweise WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-LIFR Antikörper Target Details LIFR Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Konzentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handhabung Avoid repeated freezing and thawing.
Lagerung 4 °C/-20 °C
Informationen zur Lagerung At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.


Produktdetails anti-LIFR Antikörper Target Details LIFR Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Leukemia Inhibitory Factor Receptor alpha (LIFR) (AA 863-899), (C-Term) antibody (ABIN3043410) anti-Leukemia Inhibitory Factor Receptor alpha (LIFR) (AA 863-899), (C-Term) antibody