anti-Hund GNAQ Antikörper für Western Blotting

Recommended GNAQ Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ) Antikörper
  • si:ch73-270f14.2
  • CMC1
  • G-ALPHA-q
  • GAQ
  • SWS
  • Galphaq
  • Gnaq
  • g-alpha-q
  • gaq
  • gnaqb
  • 1110005L02Rik
  • 6230401I02Rik
  • AA408290
  • AW060788
  • Dsk1
  • Dsk10
  • Gq
  • GqI
  • guanine nucleotide binding protein (G protein), q polypeptide
  • G protein subunit alpha q
  • guanine nucleotide binding protein (G protein), q polypeptide S homeolog
  • guanine nucleotide binding protein, alpha q polypeptide
  • gnaq
  • GNAQ
  • Gnaq
  • gnaq.S
Reaktivität
Human, Maus, Ratte (Rattus), Hund
91
40
37
11
10
10
4
4
4
4
3
3
2
1
Wirt
Kaninchen
65
19
7
Klonalität
Polyklonal
Konjugat
Dieser GNAQ Antikörper ist unkonjugiert
5
5
5
3
3
3
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
74
45
18
13
8
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Produktnummer ABIN634295
$ 473.93
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
10.802607 ABIN2562862 ELISA WB Goat IgG AA 162-175 Anmelden zum Anzeigen Polyclonal 0
7 ABIN768987 IHC IHC (p) WB Rabbit IgG AA 71-120 Anmelden zum Anzeigen Polyclonal 0
7 ABIN962658 ELISA IHC IHC (p) WB Goat AA 162-175 Anmelden zum Anzeigen Polyclonal 0
7 ABIN1804241 IHC IHC (p) WB Rabbit IgG AA 45-348 Anmelden zum Anzeigen Polyclonal 0
4.8026066 ABIN2785811 WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 1
4.8026066 ABIN2785812 WB Rabbit Middle Region Anmelden zum Anzeigen Polyclonal 0
4 ABIN799135 WB Rabbit AA 147-196 Anmelden zum Anzeigen Polyclonal 0
4 ABIN1734841 IHC (p) ELISA WB Goat Internal Region Anmelden zum Anzeigen Polyclonal 0
1 ABIN5554165 EIA IHC (p) WB Goat AA 162-175, Internal Region Anmelden zum Anzeigen Polyclonal 0
1 ABIN2962905 IHC (p) WB Rabbit IgG AA 45-348 Anmelden zum Anzeigen Polyclonal 0

General

Antigen Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ) Antikörper
Reaktivität Human, Maus, Ratte (Rattus), Hund
(91), (40), (37), (11), (10), (10), (4), (4), (4), (4), (3), (3), (2), (1)
Wirt Kaninchen
(65), (19), (7)
Klonalität
Polyklonal
Konjugat Dieser GNAQ Antikörper ist unkonjugiert
(5), (5), (5), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Western Blotting (WB)
(74), (45), (18), (13), (8), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-GNAQ Antikörper

Target Details GNAQ Anwendungsinformationen Handhabung Bilder
Reinigung Affinity purified
Immunogen GNAQ antibody was raised using a synthetic peptide corresponding to a region with amino acids DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
Plasmids, Primers & others

Target Details GNAQ

Produktdetails anti-GNAQ Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung GNAQ (GNAQ Antibody Abstract)
Hintergrund Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways.
Molekulargewicht 42 kDa (MW of target protein)
Pathways JAK-STAT Signalweg, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction

Anwendungsinformationen

Produktdetails anti-GNAQ Antikörper Target Details GNAQ Handhabung Bilder zurück nach oben
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

GNAQ Blocking Peptide, catalog no. 33R-2030, is also available for use as a blocking control in assays to test for specificity of this GNAQ antibody

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-GNAQ Antikörper Target Details GNAQ Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAQ antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.