anti-Human PTGES2 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended PTGES2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Prostaglandin E Synthase 2 (PTGES2) Antikörper
  • PTGES2
  • ptges2
  • zgc:56527
  • gbf1
  • pges2
  • C9orf15
  • GBF-1
  • GBF1
  • PGES2
  • mPGES-2
  • 0610038H10Rik
  • C79137
  • Gbf1
  • Mpges2
  • Pges2
  • MPGES-2
  • prostaglandin E synthase 2
  • prostaglandin E synthase 2-like
  • PTGES2
  • ptgesl
  • CpipJ_CPIJ003988
  • CpipJ_CPIJ018524
  • ptges2
  • Ptges2
Reaktivität
Human
60
30
16
4
3
2
2
2
1
Wirt
Kaninchen
54
11
3
1
Klonalität
Polyklonal
Konjugat
Dieser PTGES2 Antikörper ist unkonjugiert
1
1
Applikation
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
67
29
16
13
6
5
3
3
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN5079048
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN1500491 IF IHC IHC (p) WB Mouse IgG2a Anmelden zum Anzeigen 2C3 0
1 ABIN467562 IHC IHC (p) WB Rabbit AA 106-313 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2451694 IHC IHC (p) WB Rabbit IgG AA 221-235 Anmelden zum Anzeigen Polyclonal 0

General

Antigen Prostaglandin E Synthase 2 (PTGES2) Antikörper
Reaktivität Human
(60), (30), (16), (4), (3), (2), (2), (2), (1)
Wirt Kaninchen
(54), (11), (3), (1)
Klonalität
Polyklonal
Konjugat Dieser PTGES2 Antikörper ist unkonjugiert
(1), (1)
Applikation Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(67), (29), (16), (13), (6), (5), (3), (3), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-PTGES2 Antikörper

Target Details PTGES2 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AQDLHAERSAAQLSLSSRLQLTLYQYKTCPFCSKVRAFLDFHALPYQVVEVNPVRRAEIKFSSYRKVPILVAQEGESSQ
Isotyp IgG
Plasmids, Primers & others

Target Details PTGES2

Produktdetails anti-PTGES2 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung Prostaglandin E Synthase 2/PTGES2 (PTGES2 Antibody Abstract)
Hintergrund Gene Symbol: PTGES2
Gen-ID 80142
Pathways Interferon-gamma Pathway, Cell RedoxHomeostasis

Anwendungsinformationen

Produktdetails anti-PTGES2 Antikörper Target Details PTGES2 Handhabung Bilder zurück nach oben
Applikations-hinweise Western Blot 1:100 - 1:250, Immunohistochemistry-Paraffin 1:50 - 1:200This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-PTGES2 Antikörper Target Details PTGES2 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-PTGES2 Antikörper Target Details PTGES2 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Prostaglandin E Synthase 2 (PTGES2) antibody (ABIN5079048) Western Blot: Prostaglandin E Synthase 2/PTGES2 Antibody - Western blot analysis in ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Prostaglandin E Synthase 2 (PTGES2) antibody (ABIN5079048) Immunohistochemistry-Paraffin: Prostaglandin E Synthase 2/PTGES2 Antibody - Immunohi...