anti-Human PLCD4 Antikörper für Immunocytochemistry

Recommended PLCD4 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Phospholipase C, delta 4 (PLCD4) Antikörper
  • PLCD4
  • PLCL3
  • si:dkeyp-84a8.7
  • 4921507K24Rik
  • phospholipase C eta 1
  • phospholipase C delta 4
  • phospholipase C, delta 4a
  • phospholipase C, delta 4
  • phospholipase C delta 4 L homeolog
  • PLCH1
  • PLCD4
  • plcd4a
  • plcd4
  • Plcd4
  • plcd4.L
Reaktivität
Human
23
6
6
Wirt
Kaninchen
21
4
Klonalität
Polyklonal
Konjugat
Dieser PLCD4 Antikörper ist unkonjugiert
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
14
13
12
4
3
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4346138
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN5014114 ICC IHC WB Rabbit IgG AA 1-250 Anmelden zum Anzeigen Polyclonal 0

General

Antigen Phospholipase C, delta 4 (PLCD4) Antikörper
Reaktivität Human
(23), (6), (6)
Wirt Kaninchen
(21), (4)
Klonalität
Polyklonal
Konjugat Dieser PLCD4 Antikörper ist unkonjugiert
(1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(14), (13), (12), (4), (3), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-PLCD4 Antikörper

Target Details PLCD4 Anwendungsinformationen Handhabung Bilder
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: GFTIVFHGRRSNLDLMANSVEEAQIWMRGLQLLVDLVTSMDHQERLDQWLSDWFQRGDKNQDGKMSFQEVQRLLH
Plasmids, Primers & others

Target Details PLCD4

Produktdetails anti-PLCD4 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung PLCD4 (PLCD4 Antibody Abstract)
Hintergrund Gene Symbol: PLCD4
Gen-ID 84812
UniProt Q9BRC7
Pathways Inositol Metabolic Process

Anwendungsinformationen

Produktdetails anti-PLCD4 Antikörper Target Details PLCD4 Handhabung Bilder zurück nach oben
Applikations-hinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-PLCD4 Antikörper Target Details PLCD4 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-PLCD4 Antikörper Target Details PLCD4 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Phospholipase C, delta 4 (PLCD4) antibody (ABIN4346138) Immunocytochemistry/Immunofluorescence: PLCD4 Antibody [NBP2-38393] - Immunofluoresce...
Immunohistochemistry (IHC) image for anti-Phospholipase C, delta 4 (PLCD4) antibody (ABIN4346138) Immunohistochemistry: PLCD4 Antibody [NBP2-38393] - Staining of human testis shows mo...