anti-Human SUFUH Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended SUFUH Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Suppressor of Fused Homolog (Drosophila) (SUFUH) Antikörper
  • CG6054
  • Dmel\\CG6054
  • SU(FU)
  • SUFU
  • Su(Fu)
  • SuFu
  • Sufu
  • su(fu)
  • sufu
  • Xsufu
  • sufuh
  • sufuxl
  • PRO1280
  • SUFUH
  • SUFUXL
  • Su(fu)
  • dre
  • fi39e05
  • wu:fi39e05
  • 2810026F04Rik
  • b2b273Clo
  • Suppressor of fused
  • SUFU negative regulator of hedgehog signaling L homeolog
  • SUFU negative regulator of hedgehog signaling
  • suppressor of fused homolog (Drosophila)
  • Su(fu)
  • sufu.L
  • SUFU
  • sufu
  • Sufu
Reaktivität
Human
68
39
34
7
7
7
7
4
3
3
3
3
2
1
1
Wirt
Kaninchen
62
4
2
Klonalität
Polyklonal
Konjugat
Dieser SUFUH Antikörper ist unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
41
21
14
13
10
7
3
2
2
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4356970
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
10.864726 ABIN783266 IHC (p) Goat IgG AA 2-13 Anmelden zum Anzeigen Polyclonal 0
10.864726 ABIN1386317 IF (p) IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN959031 IHC IHC (p) WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN4356971 ICC IF IHC IHC (p) WB Rabbit IgG Center Anmelden zum Anzeigen Polyclonal 0
1 ABIN1407812 IHC (p) HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN1389919 IHC (p) Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN6244107 IHC (p) WB Mouse IgG1, kappa Anmelden zum Anzeigen 1783CT536-263-29 0

General

Antigen Suppressor of Fused Homolog (Drosophila) (SUFUH) Antikörper
Reaktivität Human
(68), (39), (34), (7), (7), (7), (7), (4), (3), (3), (3), (3), (2), (1), (1)
Wirt Kaninchen
(62), (4), (2)
Klonalität
Polyklonal
Konjugat Dieser SUFUH Antikörper ist unkonjugiert
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(41), (21), (14), (13), (10), (7), (3), (2), (2), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-SUFUH Antikörper

Target Details SUFUH Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TEELHSAQQWNGQGILELLRTVPIAGGPWLITDMRRGETIFEIDPHLQERVDKGIETDGSNLSGVSAKCAWDDLSRPPEDDEDSRSICIGTQPRRLSGKDTEQIRETLRRGLEINSKPVLPPINPQRQNGLAHDRAPSRKDSLESDSSTA
Isotyp IgG
Plasmids, Primers & others

Target Details SUFUH

Produktdetails anti-SUFUH Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung Suppressor of Fused (SUFUH Antibody Abstract)
Hintergrund Gene Symbol: SUFU
Gen-ID 51684
Pathways Hedgehog Signalweg, Tube Formation, Maintenance of Protein Location

Anwendungsinformationen

Produktdetails anti-SUFUH Antikörper Target Details SUFUH Handhabung Bilder zurück nach oben
Applikations-hinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-SUFUH Antikörper Target Details SUFUH Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-SUFUH Antikörper Target Details SUFUH Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Suppressor of Fused Homolog (Drosophila) (SUFUH) antibody (ABIN4356970) Immunocytochemistry/Immunofluorescence: Suppressor of Fused Antibody - Immunofluores...
Western Blotting (WB) image for anti-Suppressor of Fused Homolog (Drosophila) (SUFUH) antibody (ABIN4356970) Western Blot: Suppressor of Fused Antibody 230, 130, 95, 72, 56, 36, 28, 17, 11. Lan...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Suppressor of Fused Homolog (Drosophila) (SUFUH) antibody (ABIN4356970) Immunohistochemistry-Paraffin: Suppressor of Fused Antibody - Staining in human test...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Suppressor of Fused Homolog (Drosophila) (SUFUH) antibody (ABIN4356970) Immunohistochemistry-Paraffin: Suppressor of Fused Antibody - Staining of human test...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Suppressor of Fused Homolog (Drosophila) (SUFUH) antibody (ABIN4356970) Immunohistochemistry-Paraffin: Suppressor of Fused Antibody - Staining of human live...