anti-Huhn Sonic Hedgehog Antikörper für Immunohistochemistry

Recommended Sonic Hedgehog Antibody (geliefert von: Anmelden zum Anzeigen )

Sonic Hedgehog (SHH) Antikörper
  • shh
  • SHH
  • 9530036O11Rik
  • Dsh
  • Hhg1
  • Hx
  • Hxl3
  • M100081
  • HHG1
  • HLP3
  • HPE3
  • TPT
  • Xhh
  • hedgehog
  • xshh
  • fc83d08
  • syu
  • vhh-1
  • vhh1
  • wu:fc83d08
  • sonic hedgehog
  • sonic hedgehog protein A
  • sonic hedgehog L homeolog
  • sonic hedgehog a
  • shh
  • SHH
  • Shh
  • shh.L
  • shha
Huhn, Human
Dieser Sonic Hedgehog Antikörper ist unkonjugiert
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4893080
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN225218 IHC IHC (p) WB Rabbit IgG N-Term Anmelden zum Anzeigen Polyclonal 0


Antigen Sonic Hedgehog (SHH) Antikörper
Epitop N-Term
(16), (15), (9), (7), (5), (5), (5), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reaktivität Huhn, Human
(107), (76), (60), (8), (6), (5), (5), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Wirt Kaninchen
(93), (41), (10), (1)
Konjugat Dieser Sonic Hedgehog Antikörper ist unkonjugiert
(7), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(119), (53), (52), (25), (19), (13), (12), (12), (11), (10), (5), (3), (1), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-Sonic Hedgehog Antikörper

Target Details Sonic Hedgehog Anwendungsinformationen Handhabung Referenzen für anti-Sonic Hedgehog Antikörper (ABIN4893080) Bilder
Reinigung Immunogen affinity purified
Immunogen Synthetic peptides corresponding to SHH(sonic hedgehog homolog (Drosophila)) The peptide sequence was selected from the N terminal of SHH (NP_000184). Peptide sequence RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT.
Plasmids, Primers & others

Target Details Sonic Hedgehog

Produktdetails anti-Sonic Hedgehog Antikörper Anwendungsinformationen Handhabung Referenzen für anti-Sonic Hedgehog Antikörper (ABIN4893080) Bilder zurück nach oben
Andere Bezeichnung Sonic Hedgehog/Shh (SHH Antibody Abstract)
Hintergrund Gene Symbol: SHH
Molekulargewicht Theoretical MW: 28 kDa
Gen-ID 6469
UniProt Q15465
Pathways Hedgehog Signalweg, Dopaminergic Neurogenesis, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development


Produktdetails anti-Sonic Hedgehog Antikörper Target Details Sonic Hedgehog Handhabung Referenzen für anti-Sonic Hedgehog Antikörper (ABIN4893080) Bilder zurück nach oben
Applikations-hinweise Western Blot 0.2-1 μg/mL, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:1000The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-Sonic Hedgehog Antikörper Target Details Sonic Hedgehog Anwendungsinformationen Referenzen für anti-Sonic Hedgehog Antikörper (ABIN4893080) Bilder zurück nach oben
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.

Referenzen für anti-Sonic Hedgehog Antikörper (ABIN4893080)

Produktdetails anti-Sonic Hedgehog Antikörper Target Details Sonic Hedgehog Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Lozito, Tuan: "Lizard tail skeletal regeneration combines aspects of fracture healing and blastema-based regeneration." in: Development (Cambridge, England), Vol. 143, Issue 16, pp. 2946-57, 2016


Produktdetails anti-Sonic Hedgehog Antikörper Target Details Sonic Hedgehog Anwendungsinformationen Handhabung Referenzen für anti-Sonic Hedgehog Antikörper (ABIN4893080) zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Sonic Hedgehog (SHH) (N-Term) antibody (ABIN4893080) Western Blot: Sonic Hedgehog/Shh Antibody [NBP1-69270] - Lane A: Marker; Lane B HepG2...
Immunohistochemistry (IHC) image for anti-Sonic Hedgehog (SHH) (N-Term) antibody (ABIN4893080) Immunohistochemistry: Sonic Hedgehog/Shh Antibody [NBP1-69270] - Human glioma cells. ...
Immunohistochemistry (IHC) image for anti-Sonic Hedgehog (SHH) (N-Term) antibody (ABIN4893080) Immunohistochemistry: Sonic Hedgehog/Shh Antibody [NBP1-69270] - Chicken embryos Prim...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Sonic Hedgehog (SHH) (N-Term) antibody (ABIN4893080) Immunohistochemistry-Paraffin: Sonic Hedgehog/Shh Antibody [NBP1-69270] - Human Intes...