anti-Human TRIB3 Antikörper für Immunocytochemistry

Recommended TRIB3 Antibody

Tribbles Homolog 3 (Drosophila) (TRIB3) Antikörper
  • zgc:76966
  • TRIB3
  • C20orf97
  • NIPK
  • SINK
  • SKIP3
  • TRB3
  • Ifld2
  • Nipk
  • TRB-3
  • Trb3
  • tribbles pseudokinase 3
  • trib3
  • TRIB3
  • Trib3
Dieser TRIB3 Antikörper ist unkonjugiert
Immunocytochemistry (ICC), Immunofluorescence (IF)


Produktnummer ABIN5080293
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Clonality References Details
-5.610054 ABIN252371 ICC IF WB Rabbit AA 315-332 Polyclonal 3
-13.110054 ABIN4362345 ICC IF WB Rabbit AA 315-332 Polyclonal 0


Antigen Tribbles Homolog 3 (Drosophila) (TRIB3) Antikörper
Reaktivität Human
(137), (49), (17), (3), (2), (2), (2), (2), (1), (1)
Wirt Kaninchen
(133), (22)
Konjugat Dieser TRIB3 Antikörper ist unkonjugiert
(8), (7), (7), (6), (6), (6), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF)
(128), (84), (48), (16), (6), (3), (3), (1), (1)

Produktdetails anti-TRIB3 Antikörper

Target Details TRIB3 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VKNNRMSANNDHFLTPTWQQMRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAV
Isotyp IgG
Plasmids, Primers & others

Target Details TRIB3

Produktdetails anti-TRIB3 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung TRIB3 (TRIB3 Antibody Abstract)
Hintergrund Gene Symbol: TRIB3
Gen-ID 57761
Pathways Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Regulation of Lipid Metabolism by PPARalpha


Produktdetails anti-TRIB3 Antikörper Target Details TRIB3 Handhabung Bilder zurück nach oben
Applikations-hinweise Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-TRIB3 Antikörper Target Details TRIB3 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails anti-TRIB3 Antikörper Target Details TRIB3 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Tribbles Homolog 3 (Drosophila) (TRIB3) antibody (ABIN5080293) Immunocytochemistry/Immunofluorescence: TRIB3 Antibody - Staining of human cell line...
Immunofluorescence (fixed cells) (IF/ICC) image for anti-Tribbles Homolog 3 (Drosophila) (TRIB3) antibody (ABIN5080293) Immunocytochemistry/Immunofluorescence: TRIB3 Antibody - Staining of human cell line...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Tribbles Homolog 3 (Drosophila) (TRIB3) antibody (ABIN5080293) Immunohistochemistry-Paraffin: TRIB3 Antibody - Staining of human thyroid gland show...