anti-Human RMI2 Antikörper für Western Blotting

Recommended RMI2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
RMI2, RecQ Mediated Genome Instability 2, Homolog (S. Cerevisiae) (RMI2) Antikörper
  • BLAP18
  • C16orf75
  • C25H16orf75
  • C14H16orf75
  • A630055G03Rik
  • Gm537
  • Gm929
  • RecQ mediated genome instability 2
  • RMI2
  • Rmi2
Reaktivität
Human
6
Wirt
Kaninchen
6
Klonalität
Polyklonal
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
6
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4350632
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
3.0650089 ABIN2737468 WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
3.0650089 ABIN5968339 WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
3.0650089 ABIN5587047 IF IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
3.0650089 ABIN3046569 WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN5661634 WB Rabbit Anmelden zum Anzeigen Polyclonal 0
1 ABIN6146982 WB Rabbit Anmelden zum Anzeigen Polyclonal 0

General

Antigen RMI2, RecQ Mediated Genome Instability 2, Homolog (S. Cerevisiae) (RMI2) Antikörper
Reaktivität Human
(6)
Wirt Kaninchen
(6)
Klonalität
Polyklonal
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(6), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-RMI2 Antikörper

Target Details RMI2 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNI
Isotyp IgG
Plasmids, Primers & others

Target Details RMI2

Produktdetails anti-RMI2 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung RMI2 (RMI2 Antibody Abstract)
Hintergrund Gene Symbol: RMI2
Gen-ID 116028
UniProt Q96E14
Pathways DNA Reparatur

Anwendungsinformationen

Produktdetails anti-RMI2 Antikörper Target Details RMI2 Handhabung Bilder zurück nach oben
Applikations-hinweise Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation/permeabilization: PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-RMI2 Antikörper Target Details RMI2 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-RMI2 Antikörper Target Details RMI2 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-RMI2, RecQ Mediated Genome Instability 2, Homolog (S. Cerevisiae) (RMI2) antibody (ABIN4350632) Immunocytochemistry/Immunofluorescence: RMI2 Antibody [NBP1-89962] - Staining of huma...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-RMI2, RecQ Mediated Genome Instability 2, Homolog (S. Cerevisiae) (RMI2) antibody (ABIN4350632) Immunohistochemistry-Paraffin: RMI2 Antibody [NBP1-89962] - Staining of human stomach...
Western Blotting (WB) image for anti-RMI2, RecQ Mediated Genome Instability 2, Homolog (S. Cerevisiae) (RMI2) antibody (ABIN4350632) Western Blot: RMI2 Antibody [NBP1-89962] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Western Blotting (WB) image for anti-RMI2, RecQ Mediated Genome Instability 2, Homolog (S. Cerevisiae) (RMI2) antibody (ABIN4350632) Western Blot: RMI2 Antibody - Analysis in human cell lines MCF-7 and U-251MG using a...