anti-Human phospholipid Scramblase 1 Antikörper für Immunohistochemistry

Recommended phospholipid Scramblase 1 Antibody (geliefert von: Anmelden zum Anzeigen )

phospholipid Scramblase 1 (PLSCR1) Antikörper
  • mmtra1b
  • MGC84969
  • PLSCR1
  • MGC148322
  • MmTRA1a
  • MmTRA1b
  • Nor1
  • Tra1
  • Tra1a
  • Tra1b
  • Tras1
  • Tras2
  • PLSCR2
  • phospholipid scramblase 1 L homeolog
  • phospholipid scramblase 1
  • plscr1.L
  • PLS1
  • PVX_111580
  • PLSCR1
  • plscr1
  • Plscr1
  • LOC100712949
  • PLSCR2
  • LOC100341366
  • LOC611500
Immunohistochemistry (IHC), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4891695
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN2787256 IHC WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal
1 ABIN2787255 IHC WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal
1 ABIN442552 ICC IF IHC (p) IHC WB Rabbit IgG Center Anmelden zum Anzeigen Polyclonal
1 ABIN1869870 ICC IHC IP WB Rabbit IgG AA 1-318 Anmelden zum Anzeigen Polyclonal
1 ABIN2564590 IF IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1885853 IF IHC WB Rabbit AA 1-256 Anmelden zum Anzeigen Polyclonal
1 ABIN1090196 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1090197 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5623373 ELISA IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN2969795 IF/ICC IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN4238134 IHC WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal
1 ABIN2686965 IHC ELISA WB Rabbit AA 134-300 Anmelden zum Anzeigen Polyclonal
1 ABIN2149314 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2920059 ELISA IF/ICC IHC WB Rabbit AA 1-318 Anmelden zum Anzeigen Polyclonal
1 ABIN1855636 IHC ELISA WB Rabbit Anmelden zum Anzeigen Polyclonal


Antigen phospholipid Scramblase 1 (PLSCR1) Antikörper
Epitop N-Term
(15), (8), (5), (3), (2), (1), (1), (1)
Reaktivität Human
(41), (10), (6), (4), (4), (3), (2), (2), (1), (1), (1)
Wirt Kaninchen
(30), (15)
Applikation Immunohistochemistry (IHC), Western Blotting (WB)
(36), (15), (15), (9), (6), (5), (4), (3), (1)
Hersteller Anmelden zum Anzeigen


Antigendetails Anwendungsinformationen Handhabung Bilder
Reinigung Immunogen affinity purified
Immunogen Synthetic peptides corresponding to PLSCR1(phospholipid scramblase 1) Antibody(against the N terminal of PLSCR1. Peptide sequence MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP.


Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung Phospholipid Scramblase 1/PLSCR1 (PLSCR1 Antibody Abstract)
Hintergrund Gene Symbol: PLSCR1
Gen-ID 5359
UniProt O15162
Pathways Cellular Response to Molecule of Bacterial Origin


Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100-1:2000, ImmunohistochemistryThis is a rabbit polyclonal antibody against PLSCR1 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.


Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-phospholipid Scramblase 1 (PLSCR1) (N-Term) antibody (ABIN4891695) Western Blot: Phospholipid Scramblase 1/PLSCR1 Antibody [NBP1-57816] - Human 721_B, A...
Immunohistochemistry (IHC) image for anti-phospholipid Scramblase 1 (PLSCR1) (N-Term) antibody (ABIN4891695) Immunohistochemistry: Phospholipid Scramblase 1/PLSCR1 Antibody [NBP1-57816] - Formal...
Western Blotting (WB) image for anti-phospholipid Scramblase 1 (PLSCR1) (N-Term) antibody (ABIN4891695) Western Blot: Phospholipid Scramblase 1/PLSCR1 Antibody [NBP1-57816] - Human 293T, An...
Western Blotting (WB) image for anti-phospholipid Scramblase 1 (PLSCR1) (N-Term) antibody (ABIN4891695) Western Blot: Phospholipid Scramblase 1/PLSCR1 Antibody [NBP1-57816] - Hela cell lysa...