anti-Human Phosphoglycerate Kinase 1 Antikörper für Immunohistochemistry

Recommended Phosphoglycerate Kinase 1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Phosphoglycerate Kinase 1 (PGK1) Antikörper
  • PGK1
  • PGK
  • MIG10
  • PGKA
  • Pgk-1
  • Pgk
  • wu:fd59b07
  • wu:fj36g06
  • zgc:56252
  • zgc:77899
  • phosphoglycerate kinase 1
  • phosphoglycerate kinase 1
  • PGK1
  • LOC100348124
  • Pgk1
  • pgk1
Epitop
C-Term
21
14
11
6
6
6
4
4
3
3
2
2
2
2
1
1
1
1
1
1
1
Reaktivität
Human
134
67
40
5
5
5
4
4
4
4
4
3
2
1
1
1
1
Wirt
Kaninchen
115
17
5
1
Klonalität
Polyklonal
Konjugat
Unkonjugiert
8
7
7
4
4
4
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Western Blotting (WB)
118
73
53
27
22
19
13
11
7
3
3
3
3
2
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN629772
$ 388.93
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
9.120859 ABIN3032223 IHC ELISA WB Rabbit Ig Fraction AA 305-334 Anmelden zum Anzeigen Polyclonal 0
9.120859 ABIN3032224 FACS IF IHC ELISA WB Rabbit Ig Fraction AA 117-145 Anmelden zum Anzeigen Polyclonal 0
9.120859 ABIN2422891 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
9.120859 ABIN2429505 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN2783240 IHC WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal 1
1 ABIN4345073 ELISA ICC IF IHC IHC (p) WB Rabbit IgG Center Anmelden zum Anzeigen Polyclonal 1
1 ABIN1869788 ICC IHC WB Rabbit IgG AA 2-417 Anmelden zum Anzeigen Polyclonal 0
1 ABIN1874110 IF IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN2463141 IHC ELISA WB Rabbit Anmelden zum Anzeigen Polyclonal 0
1 ABIN3022690 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN2626755 IHC WB Rabbit IgG AA 166-180 Anmelden zum Anzeigen Polyclonal 0
1 ABIN4345072 IHC IHC (p) WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN1923245 IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG Internal Region Anmelden zum Anzeigen Polyclonal 0
1 ABIN1923246 IHC ELISA WB APC Rabbit IgG Internal Region Anmelden zum Anzeigen Polyclonal 0
1 ABIN1923247 IHC ELISA WB PE Rabbit IgG Internal Region Anmelden zum Anzeigen Polyclonal 0
1 ABIN2583432 ELISA FACS IF IHC WB Rabbit IgG AA 124-153 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2583433 ELISA IHC WB Rabbit IgG Internal Region Anmelden zum Anzeigen Polyclonal 0
1 ABIN2333983 FACS IF IHC ELISA WB Rabbit IgG AA 124-153, Center, Internal Region Anmelden zum Anzeigen Polyclonal 0
1 ABIN2334758 IHC ELISA WB Rabbit IgG Center Anmelden zum Anzeigen Polyclonal 0
1 ABIN1923248 ELISA FACS ICC IF IHC WB Alkaline Phosphatase (AP) Rabbit IgG AA 124-153 Anmelden zum Anzeigen Polyclonal 0

General

Antigen Phosphoglycerate Kinase 1 (PGK1) Antikörper
Epitop C-Term
(21), (14), (11), (6), (6), (6), (4), (4), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Reaktivität Human
(134), (67), (40), (5), (5), (5), (4), (4), (4), (4), (4), (3), (2), (1), (1), (1), (1)
Wirt Kaninchen
(115), (17), (5), (1)
Klonalität
Polyklonal
Konjugat Unkonjugiert
(8), (7), (7), (4), (4), (4), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Western Blotting (WB)
(118), (73), (53), (27), (22), (19), (13), (11), (7), (3), (3), (3), (3), (2), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Bilder
Spezifität PGK1 antibody was raised against the C terminal of PGK1
Reinigung Purified
Immunogen PGK1 antibody was raised using the C terminal of PGK1 corresponding to a region with amino acids ATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFAR

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung PGK1 (PGK1 Antibody Abstract)
Hintergrund PGK1 is a glycolytic enzyme that catalyzes the conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate. The protein may also act as a cofactor for polymerase alpha.
Molekulargewicht 44 kDa (MW of target protein)
Pathways Cellular Glucan Metabolic Process

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

PGK1 Blocking Peptide, catalog no. 33R-1574, is also available for use as a blocking control in assays to test for specificity of this PGK1 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGK1 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Phosphoglycerate Kinase 1 (PGK1) (C-Term) antibody (ABIN629772) PGK1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to st...
Western Blotting (WB) image for anti-Phosphoglycerate Kinase 1 (PGK1) (C-Term) antibody (ABIN629772) PGK1 antibody used at 1.25 ug/ml to detect target protein.