anti-Ratte (Rattus) Topoisomerase I Antikörper für Immunohistochemistry

Recommended Topoisomerase I Antibody (geliefert von: Anmelden zum Anzeigen )

Topoisomerase (DNA) I (TOP1) Antikörper
  • CG6146
  • Dmel\\CG6146
  • TOP1
  • TopI
  • Topo I
  • TopoI
  • dTopoI
  • l(1)G0134
  • l(1)G0201
  • l(1)G0229
  • l(1)G0278
  • l(1)top1
  • top1
  • topo I
  • topoI
  • DNA topoisomerase 1 beta
  • DNA topoisomerase I alpha
  • MGO1
  • MGOUN 1
  • MTE17.1
  • MTE17_1
  • TOPI
  • AI467334
  • D130064I21Rik
  • Top-1
  • Ab2-086
  • topi
  • Topoisomerase 1
  • DNA topoisomerase I
  • DNA topoisomerase I alpha
  • DNA topoisomerase 1
  • topoisomerase (DNA) I
  • DNA topoisomerase I, gene 1 L homeolog
  • Top1
  • top1
  • topA
  • ZMO1193
  • MRAD2831_RS63095
  • Lferr_0016
  • PC1_2015
  • Za10_0136
  • Gbro_0575
  • Dd586_2108
  • Kvar_3044
  • Alvin_2069
  • Dacet_0849
  • Mrub_1615
  • Arnit_2962
  • Ndas_4953
  • Trad_2377
  • Acear_1653
  • Mahau_0844
  • Mesop_4109
  • Thein_1586
  • Theth_0241
  • top-1
  • TOP1
  • top1.1.L
Human, Maus, Ratte (Rattus)
Dieser Topoisomerase I Antikörper ist unkonjugiert
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4361380
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN1875159 IF WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN5697520 ELISA IHC IP WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN5863932 ELISA IHC IP WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0


Antigen Topoisomerase (DNA) I (TOP1) Antikörper
Reaktivität Human, Maus, Ratte (Rattus)
(99), (37), (16), (3), (3), (3), (3), (2), (2), (1), (1), (1)
Wirt Kaninchen
(76), (22), (3)
Konjugat Dieser Topoisomerase I Antikörper ist unkonjugiert
(5), (4), (4), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(90), (36), (30), (20), (17), (14), (9), (7), (5), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-Topoisomerase I Antikörper

Target Details Topoisomerase I Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KVRASGDAKIKKEKENGFSSPPQIKDEPEDDGYFVPPKEDIKPLKRPRDEDDADYKPKK
Isotyp IgG
Plasmids, Primers & others

Target Details Topoisomerase I

Produktdetails anti-Topoisomerase I Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung Topoisomerase I (TOP1 Antibody Abstract)
Hintergrund Gene Symbol: TOP1
Gen-ID 7150
Pathways Caspase Kaskade in der Apoptose, Stem Cell Maintenance


Produktdetails anti-Topoisomerase I Antikörper Target Details Topoisomerase I Handhabung Bilder zurück nach oben
Applikations-hinweise Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-Topoisomerase I Antikörper Target Details Topoisomerase I Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails anti-Topoisomerase I Antikörper Target Details Topoisomerase I Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Topoisomerase (DNA) I (TOP1) antibody (ABIN4361380) Western Blot: Topoisomerase I Antibody - Analysis in human cell line HELA.
Western Blotting (WB) image for anti-Topoisomerase (DNA) I (TOP1) antibody (ABIN4361380) Western Blot: Topoisomerase I Antibody - Analysis in mouse cell line NIH-3T3 and rat...
Immunofluorescence (IF) image for anti-Topoisomerase (DNA) I (TOP1) antibody (ABIN4361380) Immunocytochemistry/Immunofluorescence: Topoisomerase I Antibody - Staining of human...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Topoisomerase (DNA) I (TOP1) antibody (ABIN4361380) Immunohistochemistry-Paraffin: Topoisomerase I Antibody - Staining of human skeletal...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Topoisomerase (DNA) I (TOP1) antibody (ABIN4361380) Immunohistochemistry-Paraffin: Topoisomerase I Antibody - Staining in human appendix...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Topoisomerase (DNA) I (TOP1) antibody (ABIN4361380) Immunohistochemistry-Paraffin: Topoisomerase I Antibody - Staining of human appendix...