anti-Human SPTAN1 Antikörper für Immunoprecipitation

Recommended SPTAN1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Spectrin alpha Chain, Brain (SPTAN1) Antikörper
  • im:7157190
  • wu:fa20e05
  • wu:fb33g08
  • wu:fk32a10
  • zgc:112229
  • 2610027H02Rik
  • Spna-2
  • Spna2
  • EIEE5
  • NEAS
  • SPTA2
  • A2a
  • IPF
  • SPECA
  • spectrin alpha, non-erythrocytic 1
  • spectrin, alpha, non-erythrocytic 1
  • SPTAN1
  • sptan1
  • Sptan1
Epitop
N-Term
6
6
5
5
5
5
5
5
5
5
5
5
5
5
5
4
3
2
2
2
2
2
1
1
1
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
100
63
54
29
18
5
5
4
4
4
3
3
1
1
1
Wirt
Kaninchen
139
25
Klonalität
Polyklonal
Konjugat
Dieser SPTAN1 Antikörper ist unkonjugiert
21
18
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunoprecipitation (IP), Western Blotting (WB)
143
63
37
32
20
19
19
14
14
6
3
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4890135
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN2787729 IP IHC WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 1
1 ABIN2801383 IP WB Rabbit Anmelden zum Anzeigen Polyclonal 0
1 ABIN3066669 IP WB Rabbit IgG Center Anmelden zum Anzeigen Polyclonal 0
1 ABIN2907251 IF/ICC IHC IP WB Rabbit AA 289-408 Anmelden zum Anzeigen Polyclonal 0
1 ABIN110976 ChIP IF IP WB Mouse IgG1 Anmelden zum Anzeigen 7A3 (AA6) 1
1 ABIN2907252 IF/ICC IHC IP WB Rabbit AA 922-1043 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2907253 IF/ICC IHC IP WB Rabbit AA 1573-1742 Anmelden zum Anzeigen Polyclonal 0
1 ABIN6020554 IF/ICC IHC IP WB Mouse Anmelden zum Anzeigen 0

General

Antigen Spectrin alpha Chain, Brain (SPTAN1) Antikörper
Epitop N-Term
(6), (6), (5), (5), (5), (5), (5), (5), (5), (5), (5), (5), (5), (5), (5), (4), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Reaktivität Human, Maus, Ratte (Rattus)
(100), (63), (54), (29), (18), (5), (5), (4), (4), (4), (3), (3), (1), (1), (1)
Wirt Kaninchen
(139), (25)
Klonalität
Polyklonal
Konjugat Dieser SPTAN1 Antikörper ist unkonjugiert
(21), (18), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunoprecipitation (IP), Western Blotting (WB)
(143), (63), (37), (32), (20), (19), (19), (14), (14), (6), (3), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-SPTAN1 Antikörper

Target Details SPTAN1 Anwendungsinformationen Handhabung Bilder
Reinigung Immunogen affinity purified
Immunogen Synthetic peptides corresponding to SPTAN1(spectrin, alpha, non-erythrocytic 1 (alpha-fodrin)) The peptide sequence was selected from the N terminal of SPTAN1. Peptide sequence MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ.
Plasmids, Primers & others

Target Details SPTAN1

Produktdetails anti-SPTAN1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung alpha Fodrin (SPTAN1 Antibody Abstract)
Hintergrund Gene Symbol: SPTAN1
Molekulargewicht Theoretical MW: 272 kDa
Gen-ID 6709
UniProt Q13813
Pathways Caspase Kaskade in der Apoptose, Regulation of Actin Filament Polymerization

Anwendungsinformationen

Produktdetails anti-SPTAN1 Antikörper Target Details SPTAN1 Handhabung Bilder zurück nach oben
Applikations-hinweise Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500This is a rabbit polyclonal antibody against SPTAN1 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-SPTAN1 Antikörper Target Details SPTAN1 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-SPTAN1 Antikörper Target Details SPTAN1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Spectrin alpha Chain, Brain (SPTAN1) (N-Term) antibody (ABIN4890135) Western Blot: Alpha Fodrin Antibody [NBP1-53093] - analysis of Alpha Fodrin in caco-2...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Spectrin alpha Chain, Brain (SPTAN1) (N-Term) antibody (ABIN4890135) Immunohistochemistry-Paraffin: Alpha Fodrin Antibody [NBP1-53093] - Human Kidney tiss...
Immunohistochemistry (IHC) image for anti-Spectrin alpha Chain, Brain (SPTAN1) (N-Term) antibody (ABIN4890135) Immunohistochemistry: Alpha Fodrin Antibody [NBP1-53093] - Immunohistochemistry with ...
Immunoprecipitation (IP) image for anti-Spectrin alpha Chain, Brain (SPTAN1) (N-Term) antibody (ABIN4890135) Immunoprecipitation: Alpha Fodrin Antibody [NBP1-53093] - Titration: 2 ug/ml Positive...
Immunofluorescence (IF) image for anti-Spectrin alpha Chain, Brain (SPTAN1) (N-Term) antibody (ABIN4890135) Immunocytochemistry/Immunofluorescence: Alpha Fodrin Antibody [NBP1-53093] - analysis...
Western Blotting (WB) image for anti-Spectrin alpha Chain, Brain (SPTAN1) (N-Term) antibody (ABIN4890135) Western Blot: Alpha Fodrin Antibody [NBP1-53093] - NT-2 cell line, mouse brain, and r...