anti-Human SPTAN1 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended SPTAN1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Spectrin alpha Chain, Brain (SPTAN1) Antikörper
  • im:7157190
  • wu:fa20e05
  • wu:fb33g08
  • wu:fk32a10
  • zgc:112229
  • 2610027H02Rik
  • Spna-2
  • Spna2
  • EIEE5
  • NEAS
  • SPTA2
  • A2a
  • IPF
  • SPECA
  • spectrin alpha, non-erythrocytic 1
  • spectrin, alpha, non-erythrocytic 1
  • SPTAN1
  • sptan1
  • Sptan1
Reaktivität
Human
103
64
55
29
21
5
5
4
4
4
3
3
1
1
1
Wirt
Kaninchen
139
28
Klonalität
Polyklonal
Konjugat
Dieser SPTAN1 Antikörper ist unkonjugiert
21
18
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
146
63
40
35
20
20
19
14
14
6
3
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4279749
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
10.879798 ABIN4890135 ICC IF IHC IHC (p) IP WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN959029 IHC IHC (p) WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN1938021 ICC IF IHC IHC (p) WB Rabbit AA 676-2 Anmelden zum Anzeigen Polyclonal 0
1 ABIN127066 IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN5588706 IF IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN748952 IHC (p) HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN224992 IF IHC IHC (p) WB Mouse IgG1 Anmelden zum Anzeigen 0
1 ABIN1938020 IF IHC IHC (p) Rabbit IgG AA 2422-2472 Anmelden zum Anzeigen Polyclonal 0
1 ABIN1938017 IF IHC IHC (p) WB Rabbit IgG AA 1000-1050 Anmelden zum Anzeigen Polyclonal 0
1 ABIN1938019 IF IHC IHC (p) WB Rabbit IgG AA 2422-2472 Anmelden zum Anzeigen Polyclonal 0
1 ABIN748945 IHC (p) Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN739415 IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN748943 IF (p) IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN2964296 ICC IF IHC (p) WB Rabbit AA 676-2400, C-Term Anmelden zum Anzeigen Polyclonal 0

General

Antigen Spectrin alpha Chain, Brain (SPTAN1) Antikörper
Reaktivität Human
(103), (64), (55), (29), (21), (5), (5), (4), (4), (4), (3), (3), (1), (1), (1)
Wirt Kaninchen
(139), (28)
Klonalität
Polyklonal
Konjugat Dieser SPTAN1 Antikörper ist unkonjugiert
(21), (18), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(146), (63), (40), (35), (20), (20), (19), (14), (14), (6), (3), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-SPTAN1 Antikörper

Target Details SPTAN1 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:HQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAFDYVEFTRSLF
Isotyp IgG
Plasmids, Primers & others

Target Details SPTAN1

Produktdetails anti-SPTAN1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung alpha Fodrin (SPTAN1 Antibody Abstract)
Hintergrund Gene Symbol: SPTAN1
Gen-ID 6709
Pathways Caspase Kaskade in der Apoptose, Regulation of Actin Filament Polymerization

Anwendungsinformationen

Produktdetails anti-SPTAN1 Antikörper Target Details SPTAN1 Handhabung Bilder zurück nach oben
Applikations-hinweise Western Blot 1:100 - 1:250, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-SPTAN1 Antikörper Target Details SPTAN1 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-SPTAN1 Antikörper Target Details SPTAN1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Spectrin alpha Chain, Brain (SPTAN1) antibody (ABIN4279749) Immunocytochemistry/Immunofluorescence: Alpha Fodrin Antibody [NBP1-89460] - Staining...
Western Blotting (WB) image for anti-Spectrin alpha Chain, Brain (SPTAN1) antibody (ABIN4279749) Western Blot: Alpha Fodrin Antibody [NBP1-89460] - Lane 1: Marker [kDa] 250, 130, 100...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Spectrin alpha Chain, Brain (SPTAN1) antibody (ABIN4279749) Immunohistochemistry-Paraffin: Alpha Fodrin Antibody [NBP1-89460] - Staining of human...
Western Blotting (WB) image for anti-Spectrin alpha Chain, Brain (SPTAN1) antibody (ABIN4279749) Western Blot: Alpha Fodrin Antibody - Analysis in human cell line HeLa.
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Spectrin alpha Chain, Brain (SPTAN1) antibody (ABIN4279749) Immunohistochemistry-Paraffin: Alpha Fodrin Antibody - Staining of human skeletal mu...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Spectrin alpha Chain, Brain (SPTAN1) antibody (ABIN4279749) Immunohistochemistry-Paraffin: Alpha Fodrin Antibody - Staining of human cerebral co...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Spectrin alpha Chain, Brain (SPTAN1) antibody (ABIN4279749) Immunohistochemistry-Paraffin: Alpha Fodrin Antibody - Staining of human cerebellum ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Spectrin alpha Chain, Brain (SPTAN1) antibody (ABIN4279749) Immunohistochemistry-Paraffin: Alpha Fodrin Antibody - Staining in human cerebral co...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Spectrin alpha Chain, Brain (SPTAN1) antibody (ABIN4279749) Immunohistochemistry-Paraffin: Alpha Fodrin Antibody - Staining of human kidney show...