anti-Human SATB1 Antikörper für Immunocytochemistry

Recommended SATB1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
SATB Homeobox 1 (SATB1) Antikörper
  • SATB1
  • 2610306G12Rik
  • AW413156
  • SATB homeobox 1
  • special AT-rich sequence binding protein 1
  • SATB1
  • satb1
  • Satb1
Reaktivität
Human
123
60
36
7
5
3
3
2
2
1
1
Wirt
Kaninchen
73
32
18
Klonalität
Polyklonal
Konjugat
Dieser SATB1 Antikörper ist unkonjugiert
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
105
52
41
31
26
14
14
11
7
4
3
2
2
2
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN5079483
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN5950136 FACS ICC IF IHC IHC (p) IP WB Rabbit IgG C-Term Anmelden zum Anzeigen SP05-03 0
1 ABIN2737508 ICC IP IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN5693105 ELISA FACS ICC IHC WB Rabbit AA 638-763 Anmelden zum Anzeigen Polyclonal 0
1 ABIN1832183 DB ICC Mouse IgG2b Anmelden zum Anzeigen 3548D4_2a 0
1 ABIN932488 DB ICC Mouse IgG2b Anmelden zum Anzeigen 3548D4_2a 0
1 ABIN4352119 ICC IF IHC IHC (p) WB Mouse IgG1 Transcript Variant 1 Anmelden zum Anzeigen 13D6 0
1 ABIN6248829 FACS ICC IF IHC WB Mouse IgG1 Anmelden zum Anzeigen OTI11E8 0
1 ABIN6248828 ICC IF IHC WB Mouse IgG1 Anmelden zum Anzeigen OTI10G2 0
1 ABIN6248830 ICC IF IHC WB Mouse IgG1 Anmelden zum Anzeigen OTI11H4 0
1 ABIN6248831 ICC IF IHC WB Mouse IgG1 Anmelden zum Anzeigen OTI13D6 0
1 ABIN6248833 ICC IF IHC WB Mouse IgG1 Anmelden zum Anzeigen OTI4E1 0
1 ABIN6248834 ICC IF WB Mouse IgG1 Anmelden zum Anzeigen OTI6C6 0
1 ABIN2580111 DB ICC IF WB Mouse IgG2b Anmelden zum Anzeigen 3548D4_2a 0
1 ABIN6147397 ICC IHC IP WB Rabbit Anmelden zum Anzeigen Polyclonal 0

General

Antigen SATB Homeobox 1 (SATB1) Antikörper
Reaktivität Human
(123), (60), (36), (7), (5), (3), (3), (2), (2), (1), (1)
Wirt Kaninchen
(73), (32), (18)
Klonalität
Polyklonal
Konjugat Dieser SATB1 Antikörper ist unkonjugiert
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(105), (52), (41), (31), (26), (14), (14), (11), (7), (4), (3), (2), (2), (2)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-SATB1 Antikörper

Target Details SATB1 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ENLSMIRRFLSLPQPERDAIYEQESNAVHHHGDRPPHIIHVPAEQIQSPSPTTLGKGESRGVFLPGLPTPAPWLGAAPQ
Isotyp IgG
Plasmids, Primers & others

Target Details SATB1

Produktdetails anti-SATB1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung SATB1 (SATB1 Antibody Abstract)
Hintergrund Gene Symbol: SATB1
Gen-ID 6304
Pathways Caspase Kaskade in der Apoptose, Activated T Cell Proliferation

Anwendungsinformationen

Produktdetails anti-SATB1 Antikörper Target Details SATB1 Handhabung Bilder zurück nach oben
Applikations-hinweise Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-SATB1 Antikörper Target Details SATB1 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-SATB1 Antikörper Target Details SATB1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-SATB Homeobox 1 (SATB1) antibody (ABIN5079483) Immunohistochemistry-Paraffin: SATB1 Antibody - Immunohistochemical staining of huma...
Immunofluorescence (IF) image for anti-SATB Homeobox 1 (SATB1) antibody (ABIN5079483) Immunocytochemistry/Immunofluorescence: SATB1 Antibody - Staining of human cell line...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-SATB Homeobox 1 (SATB1) antibody (ABIN5079483) Immunohistochemistry-Paraffin: SATB1 Antibody - Staining of human thymus shows stron...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-SATB Homeobox 1 (SATB1) antibody (ABIN5079483) Immunohistochemistry-Paraffin: SATB1 Antibody - Staining of human thymus shows stron...