anti-Human GAS2 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended GAS2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Growth Arrest-Specific 2 (GAS2) Antikörper
  • GAS2
  • gas2
  • si:packt119.1
  • GAS-2
  • Gas-2
  • RGD1563167
  • growth arrest specific 2
  • growth arrest-specific 2b
  • growth arrest-specific 2
  • GAS2
  • gas2b
  • Gas2
Reaktivität
Human
75
35
30
Wirt
Kaninchen
68
8
Klonalität
Polyklonal
Konjugat
Dieser GAS2 Antikörper ist unkonjugiert
5
5
4
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
55
31
21
13
10
4
3
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4313571
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN1711320 IHC (p) WB HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN1700303 IHC (p) WB Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN1713805 IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0

General

Antigen Growth Arrest-Specific 2 (GAS2) Antikörper
Reaktivität Human
(75), (35), (30)
Wirt Kaninchen
(68), (8)
Klonalität
Polyklonal
Konjugat Dieser GAS2 Antikörper ist unkonjugiert
(5), (5), (4), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(55), (31), (21), (13), (10), (4), (3), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-GAS2 Antikörper

Target Details GAS2 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: FAGYLLKHDPCRMLQISRVDGKTSPIQSKSPTLKDMNPDNYLVVSASYKAKKEI
Isotyp IgG
Plasmids, Primers & others

Target Details GAS2

Produktdetails anti-GAS2 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung GAS2 (GAS2 Antibody Abstract)
Hintergrund Gene Symbol: GAS2
Gen-ID 2620
UniProt O43903
Pathways Caspase Kaskade in der Apoptose

Anwendungsinformationen

Produktdetails anti-GAS2 Antikörper Target Details GAS2 Handhabung Bilder zurück nach oben
Applikations-hinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-GAS2 Antikörper Target Details GAS2 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-GAS2 Antikörper Target Details GAS2 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Growth Arrest-Specific 2 (GAS2) antibody (ABIN4313571) Immunohistochemistry: GAS2 Antibody [NBP2-31733] - pancreas
Immunohistochemistry (IHC) image for anti-Growth Arrest-Specific 2 (GAS2) antibody (ABIN4313571) Immunohistochemistry: GAS2 Antibody [NBP2-31733] - Staining of human kidney shows str...
Immunohistochemistry (IHC) image for anti-Growth Arrest-Specific 2 (GAS2) antibody (ABIN4313571) Immunohistochemistry: GAS2 Antibody [NBP2-31733] - breast cancer
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Growth Arrest-Specific 2 (GAS2) antibody (ABIN4313571) Immunohistochemistry-Paraffin: GAS2 Antibody - Staining of human kidney shows strong...
Immunofluorescence (IF) image for anti-Growth Arrest-Specific 2 (GAS2) antibody (ABIN4313571) Immunocytochemistry/Immunofluorescence: GAS2 Antibody - Staining of human cell line ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Growth Arrest-Specific 2 (GAS2) antibody (ABIN4313571) Immunohistochemistry-Paraffin: GAS2 Antibody - Staining of human pancreas shows low ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Growth Arrest-Specific 2 (GAS2) antibody (ABIN4313571) Immunohistochemistry-Paraffin: GAS2 Antibody - Staining of human liver shows high ex...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Growth Arrest-Specific 2 (GAS2) antibody (ABIN4313571) Immunohistochemistry-Paraffin: GAS2 Antibody - Staining in human liver and pancreas ...