anti-Hund YWHAZ Antikörper für Western Blotting

Recommended YWHAZ Antibody (geliefert von: Anmelden zum Anzeigen )

tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) Antikörper
  • 14-3-3-zeta
  • KCIP-1
  • 14-3-3zeta
  • Ywhaz
  • ACYPI003154
  • 14-3-3z
  • kcip-1
  • ywhaq
  • 1433z
  • ywhaz
  • ywhazb
  • 1110013I11Rik
  • AI596267
  • AL022924
  • AU020854
  • ywhaza
  • fb14h09
  • wu:fb05g08
  • wu:fb14h09
  • ywhai
  • zgc:55807
  • 14-3-3
  • 14-3-3 zeta
  • 14-3-3ZETA
  • 14-3-3leo
  • 2G1
  • 4-3-3 zeta
  • 5.11
  • 549
  • BEST:GH05075
  • CG17870
  • D14-3-3
  • D14-3-3zeta
  • Dmel\\CG17870
  • K
  • LEO
  • Leo
  • PAR-5
  • PAR5
  • Par-5
  • d14-3-3zeta
  • l(2)07103
  • l(2)46CFe
  • l(2)46Ee
  • leo
  • par-5
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta
  • 14-3-3 protein zeta
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta L homeolog
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta S homeolog
  • 14-3-3 protein zeta/delta pseudogene
  • CG17870 gene product from transcript CG17870-RE
  • 14-3-3zeta
  • ywhaz
  • 1433z
  • ywhaz.L
  • Ywhaz
  • ywhaz.S
  • LOC100855903
Human, Maus, Ratte (Rattus), Hund
Dieser YWHAZ Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen


Produktnummer ABIN629824
$ 388.93
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
10 ABIN1491173 IHC IHC (p) WB Rabbit AA 200-245 Anmelden zum Anzeigen Polyclonal 0
7.734015 ABIN2783207 IHC WB Rabbit Middle Region Anmelden zum Anzeigen Polyclonal 1
7 ABIN768945 IHC IHC (p) WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal 0
7 ABIN960408 IHC IHC (p) WB Rabbit AA 50-100 Anmelden zum Anzeigen Polyclonal 0
4.734015 ABIN2783206 WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal 1
4.734015 ABIN2463127 ELISA WB Rabbit Anmelden zum Anzeigen Polyclonal 0
4 ABIN321366 WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN609110 ELISA IHC IHC (p) WB Rabbit IgG AA 1-10 Anmelden zum Anzeigen Polyclonal 0
1 ABIN1731317 IHC (p) WB Rabbit IgG AA 200-245 Anmelden zum Anzeigen Polyclonal 0
1 ABIN600345 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
-6.30714 ABIN4276716 IHC (p) WB Rabbit Anmelden zum Anzeigen Polyclonal 0
-6.30714 ABIN4276714 IHC (p) WB Rabbit Anmelden zum Anzeigen Polyclonal 0
-13.041155 ABIN4276715 IHC (p) WB Rabbit Anmelden zum Anzeigen Polyclonal 0
-13.041155 ABIN4276713 IHC (p) WB Rabbit Anmelden zum Anzeigen Polyclonal 0


Antigen tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) Antikörper
Epitop C-Term
(54), (13), (11), (11), (11), (10), (10), (8), (7), (7), (4), (4), (4), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reaktivität Human, Maus, Ratte (Rattus), Hund
(243), (170), (134), (29), (24), (21), (20), (14), (7), (7), (6), (6), (4), (4), (3), (3), (2), (2), (1)
Wirt Kaninchen
(235), (11)
Konjugat Dieser YWHAZ Antikörper ist unkonjugiert
(7), (6), (5), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Western Blotting (WB)
(224), (131), (90), (64), (62), (24), (15), (13), (12), (7), (3), (3)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-YWHAZ Antikörper

Target Details YWHAZ Anwendungsinformationen Handhabung Bilder
Spezifität YWHAZ antibody was raised against the C terminal of YWHAZ
Reinigung Purified
Immunogen YWHAZ antibody was raised using the C terminal of YWHAZ corresponding to a region with amino acids AFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGE
Plasmids, Primers & others

Target Details YWHAZ

Produktdetails anti-YWHAZ Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung YWHAZ (YWHAZ Antibody Abstract)
Hintergrund YWHAZ belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity.
Molekulargewicht 28 kDa (MW of target protein)
Pathways Apoptose, Hormone Transport, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location


Produktdetails anti-YWHAZ Antikörper Target Details YWHAZ Handhabung Bilder zurück nach oben
Applikations-hinweise WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

YWHAZ Blocking Peptide, catalog no. 33R-1158, is also available for use as a blocking control in assays to test for specificity of this YWHAZ antibody

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-YWHAZ Antikörper Target Details YWHAZ Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YWHAZ antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.


Produktdetails anti-YWHAZ Antikörper Target Details YWHAZ Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) (C-Term) antibody (ABIN629824) YWHAZ antibody used at 5 ug/ml to detect target protein.