anti-Human TREX1 Antikörper für Western Blotting

Recommended TREX1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
three Prime Repair Exonuclease 1 (TREX1) Antikörper
  • AGS1
  • CRV
  • DRN3
  • HERNS
  • 1661
  • AU041952
  • RGD1309596
  • three prime repair exonuclease 1
  • CpipJ_CPIJ012074
  • Tsp_03749
  • TREX1
  • Trex1
Epitop
AA 156-185, Middle Region
5
4
4
4
3
3
3
3
2
2
2
2
1
1
Reaktivität
Human
71
12
9
Wirt
Kaninchen
44
30
Klonalität
Polyklonal
Konjugat
Dieser TREX1 Antikörper ist unkonjugiert
3
3
2
2
2
2
2
2
2
2
2
2
2
2
1
1
1
Applikation
Western Blotting (WB)
68
37
26
25
18
16
4
2
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN3043537
$ 240.00
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
3.2534187 ABIN524703 WB Rabbit AA 1-369, full length Anmelden zum Anzeigen Polyclonal 2
3.2534187 ABIN524701 WB Mouse AA 1-369, full length Anmelden zum Anzeigen Polyclonal 0
3.2534187 ABIN1031144 IHC ELISA WB Rabbit Middle Region Anmelden zum Anzeigen Polyclonal 0
3.2534187 ABIN2560538 IF IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
3.2534187 ABIN524705 ELISA WB Mouse IgG2b kappa AA 1-100, partial Anmelden zum Anzeigen 2F10 0
3.2534187 ABIN524700 WB Mouse AA 1-304, full length Anmelden zum Anzeigen Polyclonal 0
3.2534187 ABIN524704 WB Rabbit AA 1-304, full length Anmelden zum Anzeigen Polyclonal 0
3.2534187 ABIN524702 WB Mouse AA 1-369, full length Anmelden zum Anzeigen Polyclonal 0
3.2534187 ABIN2967111 IC IF WB Rabbit Anmelden zum Anzeigen Polyclonal 0
3.2534187 ABIN4249334 ICC IF IP WB Mouse IgG1 Anmelden zum Anzeigen 11 0
3.2534187 ABIN5014396 ICC IHC WB Rabbit IgG AA 6-369 Anmelden zum Anzeigen Polyclonal 0
1 ABIN341718 ELISA IHC WB Rabbit Internal Region Anmelden zum Anzeigen Polyclonal 0
1 ABIN524706 ELISA WB Mouse IgG2a kappa AA 1-100, partial Anmelden zum Anzeigen 1B1 0
1 ABIN5673160 WB Rabbit Middle Region Anmelden zum Anzeigen Polyclonal 0
1 ABIN2882441 IF WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN5555375 EIA IHC (p) WB Rabbit IgG Center Anmelden zum Anzeigen Polyclonal 0
1 ABIN4362286 ELISA ICC IF IHC IHC (p) WB Rabbit Center Anmelden zum Anzeigen Polyclonal 0
1 ABIN4362289 WB Rabbit IgG Center Anmelden zum Anzeigen Polyclonal 0
1 ABIN2751825 ELISA IF IHC IP WB FITC Rabbit IgG AA 220-245 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2751824 ELISA IF IHC IP WB Rabbit IgG AA 220-245 Anmelden zum Anzeigen Polyclonal 0

General

Antigen three Prime Repair Exonuclease 1 (TREX1) Antikörper
Epitop AA 156-185, Middle Region
(5), (4), (4), (4), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1)
Reaktivität Human
(71), (12), (9)
Wirt Kaninchen
(44), (30)
Klonalität
Polyklonal
Konjugat Dieser TREX1 Antikörper ist unkonjugiert
(3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Applikation Western Blotting (WB)
(68), (37), (26), (25), (18), (16), (4), (2), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-TREX1 Antikörper

Target Details TREX1 Anwendungsinformationen Handhabung Bilder
Verwendungszweck Rabbit IgG polyclonal antibody for Three-prime repair exonuclease 1(TREX1) detection. Tested with WB in Human.
Sequenz DDNLANLLLA FLRRQPQPWC LVAHNGDRYD
Kreuzreaktivität (Details) No cross reactivity with other proteins.
Produktmerkmale Rabbit IgG polyclonal antibody for Three-prime repair exonuclease 1(TREX1) detection. Tested with WB in Human.
Gene Name: three prime repair exonuclease 1
Protein Name: Three-prime repair exonuclease 1
Reinigung Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human TREX1 (156-185aa DDNLANLLLAFLRRQPQPWCLVAHNGDRYD), different from the related mouse sequence by four amino acids.
Isotyp IgG

Target Details TREX1

Produktdetails anti-TREX1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung TREX1 (TREX1 Antibody Abstract)
Hintergrund Three prime repair exonuclease 1 is an enzyme that in humans is encoded by the TREX1 gene. This gene encodes a nuclear protein with 3' exonuclease activity. The encoded protein may play a role in DNA repair and serve as a proofreading function for DNA polymerase. It is also a component of the SET complex, and acts to rapidly degrade 3' ends of nicked DNA during granzyme A-mediated cell death. Mutations in this gene result in Aicardi-Goutieres syndrome, chilblain lupus, Cree encephalitis, and other diseases of the immune system. Alternative splicing results in multiple transcript variants.

Synonyms: 3' 5' exonuclease TREX1 antibody|3' repair exonuclease 1 antibody|AGS1 antibody|AGS5 antibody|CRV antibody|Deoxyribonuclease III, dnaQ/mutD (E. coli) like antibody|DKFZp434J0310 antibody|DNase III antibody|DRN3 antibody|HERNS antibody|Three prime repair exonuclease 1 antibody|TREX1 antibody
Gen-ID 11277
Pathways Apoptose

Anwendungsinformationen

Produktdetails anti-TREX1 Antikörper Target Details TREX1 Handhabung Bilder zurück nach oben
Applikationshinweise WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.
Kommentare

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-TREX1 Antikörper Target Details TREX1 Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Konzentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handhabung Avoid repeated freezing and thawing.
Lagerung 4 °C/-20 °C
Informationen zur Lagerung At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Bilder

Produktdetails anti-TREX1 Antikörper Target Details TREX1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-three Prime Repair Exonuclease 1 (TREX1) (AA 156-185), (Middle Region) antibody (ABIN3043537) anti-three Prime Repair Exonuclease 1 (TREX1) (AA 156-185), (Middle Region) antibody