ITGA3 Antikörper (Cytoplasmic Domain)
-
- Target Alle ITGA3 Antikörper anzeigen
- ITGA3 (Integrin, alpha 3 (ITGA3))
-
Bindungsspezifität
- Cytoplasmic Domain
-
Reaktivität
- Human
-
Wirt
- Maus
-
Klonalität
- Monoklonal
-
Konjugat
- Dieser ITGA3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro))
- Spezifität
- Reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit alpha-3A. A broad species reactivity is expected because of the conserved nature of the epitope.
- Aufreinigung
- Purified
- Immunogen
- Peptide corresponding to the cytoplasmic domain of the integrin subunit alpha-3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin
- Klon
- 158A3
- Isotyp
- IgG2a
- Top Product
- Discover our top product ITGA3 Primärantikörper
-
-
- Applikationshinweise
-
Approved: ICC, IHC, IHC-Fr (1:100 - 1:200), WB (1:100 - 1:1000)
Not recommended for: IHC-P - Kommentare
-
Target Species of Antibody: Human
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Liquid
- Konzentration
- Lot specific
- Buffer
- PBS containing 0.09 % sodium azide
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- avoid freeze thaw cycles. Store undiluted.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
- Short term 4°C, long term aliquot and store at -20°C, avoid freeze-thaw cycles. Store undiluted.
-
- Target
- ITGA3 (Integrin, alpha 3 (ITGA3))
- Andere Bezeichnung
- ITGA3 / CD49c (ITGA3 Produkte)
- Synonyme
- CD49C antikoerper, GAP-B3 antikoerper, GAPB3 antikoerper, ILNEB antikoerper, MSK18 antikoerper, VCA-2 antikoerper, VL3A antikoerper, VLA3a antikoerper, ITGA3 antikoerper, AA407068 antikoerper, integrin subunit alpha 3 antikoerper, integrin subunit alpha 3 S homeolog antikoerper, integrin alpha 3 antikoerper, ITGA3 antikoerper, itga3.S antikoerper, Itga3 antikoerper
- Hintergrund
-
Name/Gene ID: ITGA3
Family: Integrin
Synonyms: ITGA3, Alpha3 integrin, CD49c antigen, CD49C, GAPB3, Integrin alpha-3, FRP-2, VCA-2, VLA-3 subunit alpha, VL3A, VLA3a, Galactoprotein B3, GAP-B3, ILNEB, Integrin alpha3, MSK18 - Gen-ID
- 3675
- UniProt
- P26006
- Pathways
- CXCR4-mediated Signaling Events, Integrin Complex
-