Tissue factor Antikörper (AA 45-154)

Produktnummer ABIN947845

Produktdetails anti-Tissue factor Antikörper

Target: Tissue factor (F3) (Coagulation Factor III (thromboplastin, Tissue Factor) (F3))

Bindungsspezifität: AA 45-154

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser Tissue factor Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), ELISA

Verwendungszweck: Mouse monoclonal antibody raised against a partial recombinant F3.

Kreuzreaktivität: Human

Immunogen:

immunogen: F3 (AAH11029, 45 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: TWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTK

Klon: 4G4

Isotyp: IgG2a kappa

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Buffer: In ascites fluid

Handhabung: Aliquot to avoid repeated freezing and thawing.

Lagerung: -20 °C

Informationen zur Lagerung: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Referenzen für anti-Tissue factor Antikörper (ABIN947845)

Cugno, Marzano, Lorini, Carbonelli, Tedeschi: "Enhanced tissue factor expression by blood eosinophils from patients with hypereosinophilia: a possible link with thrombosis." in: PLoS ONE, Vol. 9, Issue 11, pp. e111862, (2014) (PubMed).

Details zu Tissue factor

Target: Tissue factor (F3) (Coagulation Factor III (thromboplastin, Tissue Factor) (F3))

Andere Bezeichnung: F3 (F3 Produkte)

Synonyme: CD142 antikoerper, TF antikoerper, TFA antikoerper, PRO1557 antikoerper, PRO2086 antikoerper, TFQTL1 antikoerper, f3 antikoerper, AA409063 antikoerper, Cf-3 antikoerper, Cf3 antikoerper, tf antikoerper, zgc:112151 antikoerper, coagulation factor III, tissue factor antikoerper, transferrin antikoerper, coagulation factor IIIa antikoerper, coagulation factor III antikoerper, tissue factor antikoerper, coagulation factor IIIb antikoerper, coagulation factor III (thromboplastin, tissue factor) S homeolog antikoerper, F3 antikoerper, TF antikoerper, f3a antikoerper, tf antikoerper, f3b antikoerper, f3.S antikoerper

Hintergrund: Full Gene Name: coagulation factor III (thromboplastin, tissue factor)
Synonyms: CD142,TF,TFA

Gen-ID: 2152

Pathways: Positive Regulation of Endopeptidase Activity, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling