CRB1 Antikörper

Produktnummer ABIN6719658

Produktdetails anti-CRB1 Antikörper

Target: CRB1 (Crumbs Homolog 1 (CRB1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CRB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for CRB1 detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: FRTRDANVII LHAEKEPEFL NISIQDSRLF FQLQ

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for CRB1 detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence of human CRB1 (FRTRDANVIILHAEKEPEFLNISIQDSRLFFQLQ).

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise:

Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL

Kommentare:

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu CRB1

Target: CRB1 (Crumbs Homolog 1 (CRB1))

Andere Bezeichnung: CRB1 (CRB1 Produkte)

Synonyme: CRB1 antikoerper, si:dkey-114d20.6 antikoerper, si:dkey-114d20.7 antikoerper, LCA8 antikoerper, RP12 antikoerper, 7530426H14Rik antikoerper, A930008G09Rik antikoerper, crumbs 1, cell polarity complex component antikoerper, crumbs family member 1, photoreceptor morphogenesis associated antikoerper, CRB1 antikoerper, crb1 antikoerper, Crb1 antikoerper

Hintergrund:

Synonyms: Protein crumbs homolog 1, CRB1

Background: Crumbs homolog 1 is a protein that in humans is encoded by the CRB1 gene. This gene encodes a protein which is similar to the Drosophila crumbs protein and localizes to the inner segment of mammalian photoreceptors. In Drosophila crumbs localizes to the stalk of the fly photoreceptor and may be a component of the molecular scaffold that controls proper development of polarity in the eye. Mutations in this gene are associated with a severe form of retinitis pigmentosa, RP12, and with Leber congenital amaurosis. Alternate splicing results in multiple transcript variants, some protein coding and some non-protein coding.

Gen-ID: 23418

UniProt: P82279

Pathways: Notch Signalweg