SCN4B Antikörper

Produktnummer ABIN6719653

Produktdetails anti-SCN4B Antikörper

Target: SCN4B (Sodium Channel, Voltage-Gated, Type IV, beta Subunit (SCN4B))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SCN4B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for SCN4B detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: LRDLEFSDTG KYTCHVKNPK ENNLQHHATI FLQ

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for SCN4B detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence of human SCN4B (LRDLEFSDTGKYTCHVKNPKENNLQHHATIFLQ).

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise:

Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL

Kommentare:

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu SCN4B

Target: SCN4B (Sodium Channel, Voltage-Gated, Type IV, beta Subunit (SCN4B))

Andere Bezeichnung: SCN4B (SCN4B Produkte)

Synonyme: LQT10 antikoerper, Navbeta4 antikoerper, Gm1471 antikoerper, sb:cb973 antikoerper, scn4b.2 antikoerper, si:ch211-139a5.5 antikoerper, scn4b.1 antikoerper, scn4b1 antikoerper, zgc:165389 antikoerper, sodium voltage-gated channel beta subunit 4 antikoerper, sodium channel, type IV, beta antikoerper, sodium channel, voltage-gated, type IV, beta b antikoerper, sodium channel, voltage-gated, type IV, beta a antikoerper, SCN4B antikoerper, Scn4b antikoerper, scn4bb antikoerper, scn4ba antikoerper

Hintergrund:

Synonyms: Sodium channel subunit beta-4, SCN4B

Background: Sodium channel β-subunit 4, also known as SCN4B or Naβ4, is a protein that in humans is encoded by the SCN4B gene. The protein encoded by this gene is one of several sodium channel beta subunits. These subunits interact with voltage-gated alpha subunits to change sodium channel kinetics. The encoded transmembrane protein forms interchain disulfide bonds with SCN2A. Defects in this gene are a cause of long QT syndrome type 10 (LQT10). Three protein-coding and one non-coding transcript variant have been found for this gene.

Gen-ID: 6330