CLEC9A Antikörper

Produktnummer ABIN6719546

Produktdetails anti-CLEC9A Antikörper

Target: CLEC9A (C-Type Lectin Domain Family 9, Member A (CLEC9A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CLEC9A Antikörper ist unkonjugiert

Applikation: Flow Cytometry (FACS), Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro))

Verwendungszweck: Rabbit IgG polyclonal antibody for CLEC9A detection. Tested with IHC-F, ICC, FCM in Human.

Sequenz: EIWSIWHTSQ ENCLKEGSTL LQIESKEEMD FITGSLRKIK

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for CLEC9A detection. Tested with IHC-F, ICC, FCM in Human.

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence of human CLEC9A (EIWSIWHTSQENCLKEGSTLLQIESKEEMDFITGSLRKIK).

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise:

Application details: Immunohistochemistry(Frozen Section)|0.5-1 μg/mL Immunocytochemistry|0.5-1 μg/mL Flow Cytometry|1-3 μg/1x106 cells

Kommentare:

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu CLEC9A

Target: CLEC9A (C-Type Lectin Domain Family 9, Member A (CLEC9A))

Andere Bezeichnung: CLEC9A (CLEC9A Produkte)

Synonyme: 9830005G06Rik antikoerper, DNGR-1 antikoerper, DNGR1 antikoerper, UNQ9341 antikoerper, RGD1562513 antikoerper, C-type lectin domain family 9, member a antikoerper, C-type lectin domain containing 9A antikoerper, C-type lectin domain family 9, member A antikoerper, Clec9a antikoerper, CLEC9A antikoerper

Hintergrund:

Synonyms: C-type lectin domain family 9 member A, CLEC9A, UNQ9341/PRO34046

Background: C-type lectin domain family 9 member A is a protein that in humans is encoded by the CLEC9A gene. CLEC9A is a group V C-type lectin-like receptor (CTLR) that functions as an activation receptor and is expressed on myeloid lineage cells. By genomic sequence analysis, this gene is mapped to chromosome 12p13.31, centromeric to CLEC12B (617573) and telomeric to CLEC1A (606782).

Gen-ID: 283420