PRND Antikörper

Produktnummer ABIN6719483

Produktdetails anti-PRND Antikörper

Target: PRND (Prion Protein 2 (Dublet) (PRND))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRND Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Doppel detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: ATQAANQGEF QKPDNKLHQQ VLWRLVQELC SLKH

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Doppel detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence of human Doppel (ATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKH).

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise:

Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL

Kommentare:

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu PRND

Target: PRND (Prion Protein 2 (Dublet) (PRND))

Andere Bezeichnung: PRND (PRND Produkte)

Synonyme: PRND antikoerper, DOPPEL antikoerper, DPL antikoerper, PrPLP antikoerper, dJ1068H6.4 antikoerper, dpl antikoerper, AI450264 antikoerper, Dpl antikoerper, doppel antikoerper, prion like protein doppel antikoerper, PRND antikoerper, Prnd antikoerper

Hintergrund:

Synonyms: Prion-like protein doppel, PrPLP, Prion protein 2, PRND, DPL, UNQ1830/PRO3443

Background: Prion protein 2 (dublet), also known as PRND, or Doppel protein, is a protein which in humans is encoded by the PRND gene. It is mapped to 20p13. This gene is found on chromosome 20, approximately 20 kbp downstream of the gene encoding cellular prion protein, to which it is biochemically and structurally similar. The protein encoded by this gene is a membrane glycosylphosphatidylinositol-anchored glycoprotein that is found predominantly in testis. Mutations in this gene may lead to neurological disorders.

Gen-ID: 23627

Pathways: Transition Metal Ion Homeostasis