CGRP Antikörper

Produktnummer ABIN6654110

Produktdetails anti-CGRP Antikörper

Target: CGRP (CALCA) (Calcitonin-Related Polypeptide alpha (CALCA))

Reaktivität: Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CGRP Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids CGNLSTCMLGTYTQDLNKFHTFPQTSIGVEAP were used as the immunogen for the Calcitonin antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Calcitonin antibody should be determined by the researcher.\. Immunohistochemistry (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the Calcitonin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu CGRP

Target: CGRP (CALCA) (Calcitonin-Related Polypeptide alpha (CALCA))

Andere Bezeichnung: Calcitonin / CALCA / CGRP (CALCA Produkte)

Synonyme: CALC1 antikoerper, CGRP antikoerper, CGRP-I antikoerper, CGRP1 antikoerper, CT antikoerper, KC antikoerper, CALC antikoerper, CALCA antikoerper, CALC3 antikoerper, ci-ct antikoerper, calca antikoerper, CA antikoerper, CGRP-1 antikoerper, Calc antikoerper, Calc1 antikoerper, Cgrp antikoerper, Ct antikoerper, Ctn antikoerper, calcitonin antikoerper, CAL6 antikoerper, Cal1 antikoerper, RATCAL6 antikoerper, CGRPI antikoerper, calc antikoerper, cgrp antikoerper, zgc:92886 antikoerper, calcitonin related polypeptide alpha antikoerper, calcitonin related polypeptide beta antikoerper, calcitonin-related polypeptide alpha antikoerper, calcitonin antikoerper, calcitonin/calcitonin-related polypeptide, alpha antikoerper, calcitonin-related polypeptide beta antikoerper, calcitonin gene-related peptide 2 antikoerper, CALCA antikoerper, CALCB antikoerper, ci-ct antikoerper, calca antikoerper, Calca antikoerper, LOC100008771 antikoerper

Hintergrund: Calcitonin, also known as CALCA, is a peptide hormone synthesized by the parafollicular cells of the thyroid. It is mapped to 11p15.2. Calcitonin belongs to the calcitonin-like protein family. Calcitonin is involved in calcium regulation and acts to regulate phosphorus metabolism. Calcitonin gene-related peptide functions as a vasodilator and as an antimicrobial peptide while katacalcin is a calcium-lowering peptide. Multiple transcript variants encoding different isoforms have been found for this gene.

UniProt: P70160

Pathways: Hormone Activity, cAMP Metabolic Process, Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, Skeletal Muscle Fiber Development, Feeding Behaviour