LRFN5 Antikörper (Middle Region)

Produktnummer ABIN636112

Produktdetails anti-LRFN5 Antikörper

Target: LRFN5 (Leucine Rich Repeat and Fibronectin Type III Domain Containing 5 (LRFN5))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRFN5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LRFN5 antibody was raised against the middle region of LRFN5

Aufreinigung: Affinity purified

Immunogen: LRFN5 antibody was raised using the middle region of LRFN5 corresponding to a region with amino acids PLITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRFN5 Blocking Peptide, catalog no. 33R-7195, is also available for use as a blocking control in assays to test for specificity of this LRFN5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRFN5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRFN5

Target: LRFN5 (Leucine Rich Repeat and Fibronectin Type III Domain Containing 5 (LRFN5))

Andere Bezeichnung: LRFN5 (LRFN5 Produkte)

Synonyme: C14orf146 antikoerper, FIGLER8 antikoerper, SALM5 antikoerper, AI427653 antikoerper, AI604817 antikoerper, C130061B21 antikoerper, mKIAA4208 antikoerper, leucine rich repeat and fibronectin type III domain containing 5 antikoerper, LRFN5 antikoerper, Lrfn5 antikoerper

Hintergrund: The specific function of LRFN5 is not yet known.

Molekulargewicht: 79 kDa (MW of target protein)