LRFN5 Antikörper (Middle Region)
-
- Target Alle LRFN5 Antikörper anzeigen
- LRFN5 (Leucine Rich Repeat and Fibronectin Type III Domain Containing 5 (LRFN5))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LRFN5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LRFN5 antibody was raised against the middle region of LRFN5
- Aufreinigung
- Affinity purified
- Immunogen
- LRFN5 antibody was raised using the middle region of LRFN5 corresponding to a region with amino acids PLITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLV
- Top Product
- Discover our top product LRFN5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LRFN5 Blocking Peptide, catalog no. 33R-7195, is also available for use as a blocking control in assays to test for specificity of this LRFN5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRFN5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LRFN5 (Leucine Rich Repeat and Fibronectin Type III Domain Containing 5 (LRFN5))
- Andere Bezeichnung
- LRFN5 (LRFN5 Produkte)
- Synonyme
- C14orf146 antikoerper, FIGLER8 antikoerper, SALM5 antikoerper, AI427653 antikoerper, AI604817 antikoerper, C130061B21 antikoerper, mKIAA4208 antikoerper, leucine rich repeat and fibronectin type III domain containing 5 antikoerper, LRFN5 antikoerper, Lrfn5 antikoerper
- Hintergrund
- The specific function of LRFN5 is not yet known.
- Molekulargewicht
- 79 kDa (MW of target protein)
-