SLC22A7 Antikörper
-
- Target Alle SLC22A7 Antikörper anzeigen
- SLC22A7 (Solute Carrier Family 22 (Organic Cation Transporter), Member 7 (SLC22A7))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC22A7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC22 A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSLPKLTYGGIALLAAGTALLLPETRQAQLPETIQDVERKSAPTSLQEEE
- Top Product
- Discover our top product SLC22A7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC22A7 Blocking Peptide, catalog no. 33R-5435, is also available for use as a blocking control in assays to test for specificity of this SLC22A7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC22A7 (Solute Carrier Family 22 (Organic Cation Transporter), Member 7 (SLC22A7))
- Andere Bezeichnung
- SLC22A7 (SLC22A7 Produkte)
- Synonyme
- NLT antikoerper, OAT2 antikoerper, Oat2 antikoerper, oat2 antikoerper, nlt antikoerper, slc22a7 antikoerper, im:6901703 antikoerper, im:7155670 antikoerper, oat2a antikoerper, zgc:162334 antikoerper, oat2e antikoerper, slc22a7b antikoerper, zgc:63958 antikoerper, solute carrier family 22 member 7 antikoerper, solute carrier family 22 (organic anion transporter), member 7 antikoerper, solute carrier family 22 (organic anion transporter), member 7 L homeolog antikoerper, solute carrier family 22 (organic anion transporter), member 7a antikoerper, solute carrier family 22 (organic anion transporter), member 7b, tandem duplicate 1 antikoerper, SLC22A7 antikoerper, Slc22a7 antikoerper, slc22a7.L antikoerper, slc22a7a antikoerper, slc22a7b.1 antikoerper
- Hintergrund
- SLC22A7 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.
- Molekulargewicht
- 26 kDa (MW of target protein)
-