CYP2A7 Antikörper (N-Term)

Produktnummer ABIN636074

Produktdetails anti-CYP2A7 Antikörper

Target: CYP2A7 (Cytochrome P450, Family 2, Subfamily A, Polypeptide 7 (CYP2A7))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYP2A7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CYP2 A7 antibody was raised against the N terminal of CYP2 7

Aufreinigung: Affinity purified

Immunogen: CYP2 A7 antibody was raised using the N terminal of CYP2 7 corresponding to a region with amino acids MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CYP2A7 Blocking Peptide, catalog no. 33R-6180, is also available for use as a blocking control in assays to test for specificity of this CYP2A7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CYP2A7

Target: CYP2A7 (Cytochrome P450, Family 2, Subfamily A, Polypeptide 7 (CYP2A7))

Andere Bezeichnung: CYP2A7 (CYP2A7 Produkte)

Synonyme: CPA7 antikoerper, CPAD antikoerper, CYP2A antikoerper, CYPIIA7 antikoerper, P450-IIA4 antikoerper, cytochrome P450 family 2 subfamily A member 7 antikoerper, CYP2A7 antikoerper

Hintergrund: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum, its substrate has not yet been determined. This gene, which produces two transcript variants, is part of a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q.

Molekulargewicht: 56 kDa (MW of target protein)