ST6GALNAC2 Antikörper (Middle Region)
-
- Target Alle ST6GALNAC2 Antikörper anzeigen
- ST6GALNAC2 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 2 (ST6GALNAC2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ST6GALNAC2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ST6 GALNAC2 antibody was raised against the middle region of ST6 ALNAC2
- Aufreinigung
- Affinity purified
- Immunogen
- ST6 GALNAC2 antibody was raised using the middle region of ST6 ALNAC2 corresponding to a region with amino acids VNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVP
- Top Product
- Discover our top product ST6GALNAC2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ST6GALNAC2 Blocking Peptide, catalog no. 33R-9714, is also available for use as a blocking control in assays to test for specificity of this ST6GALNAC2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 ALNAC2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ST6GALNAC2 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 2 (ST6GALNAC2))
- Andere Bezeichnung
- ST6GALNAC2 (ST6GALNAC2 Produkte)
- Synonyme
- SAITL1 antikoerper, SIAT7 antikoerper, SIAT7B antikoerper, SIATL1 antikoerper, ST6GalNAII antikoerper, STHM antikoerper, II antikoerper, ST6GalNAc antikoerper, Siat7 antikoerper, Siat7b antikoerper, ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 2 antikoerper, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2 antikoerper, ST6GALNAC2 antikoerper, St6galnac2 antikoerper
- Hintergrund
- ST6GALNAC2 belongs to a family of sialyltransferases that add sialic acids to the nonreducing ends of glycoconjugates. At the cell surface, these modifications have roles in cell-cell and cell-substrate interactions, bacterial adhesion, and protein targeting.
- Molekulargewicht
- 42 kDa (MW of target protein)
-