DHRS7B Antikörper

Produktnummer ABIN635978

Produktdetails anti-DHRS7B Antikörper

Target: DHRS7B (Dehydrogenase/reductase (SDR Family) Member 7B (DHRS7B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DHRS7B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DHRS7 B antibody was raised using a synthetic peptide corresponding to a region with amino acids QAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTTA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DHRS7B Blocking Peptide, catalog no. 33R-7459, is also available for use as a blocking control in assays to test for specificity of this DHRS7B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHRS0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DHRS7B

Target: DHRS7B (Dehydrogenase/reductase (SDR Family) Member 7B (DHRS7B))

Andere Bezeichnung: DHRS7B (DHRS7B Produkte)

Synonyme: MGC146711 antikoerper, SDR32C1 antikoerper, BC003479 antikoerper, C79874 antikoerper, C80074 antikoerper, PexRAP antikoerper, RGD1311243 antikoerper, zgc:112518 antikoerper, dehydrogenase/reductase 7B antikoerper, dehydrogenase/reductase (SDR family) member 7B antikoerper, dehydrogenase/reductase (SDR family) member 7B L homeolog antikoerper, DHRS7B antikoerper, dhrs7b antikoerper, Dhrs7b antikoerper, dhrs7b.L antikoerper

Hintergrund: This gene is located within the Smith-Magenis syndrome region on chromosome 17. It encodes a protein of unknown function.

Molekulargewicht: 35 kDa (MW of target protein)