SLC35A3 Antikörper
-
- Target Alle SLC35A3 Antikörper anzeigen
- SLC35A3 (Solute Carrier Family 35 (UDP-N-Acetylglucosamine (UDP-GlcNAc) Transporter), Member A3 (SLC35A3))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC35A3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC35 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VAFVQWPSDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKET
- Top Product
- Discover our top product SLC35A3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC35A3 Blocking Peptide, catalog no. 33R-9415, is also available for use as a blocking control in assays to test for specificity of this SLC35A3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC35A3 (Solute Carrier Family 35 (UDP-N-Acetylglucosamine (UDP-GlcNAc) Transporter), Member A3 (SLC35A3))
- Andere Bezeichnung
- SLC35A3 (SLC35A3 Produkte)
- Synonyme
- 2310050P13Rik antikoerper, solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member 3 antikoerper, solute carrier family 35 member A3 antikoerper, Slc35a3 antikoerper, SLC35A3 antikoerper
- Hintergrund
- SLC35A3 is a uridine diphosphate-N-acetylglucosamine transporter in the Golgi apparatus.
- Molekulargewicht
- 36 kDa (MW of target protein)
-