SLC24A1 Antikörper

Produktnummer ABIN635940

Produktdetails anti-SLC24A1 Antikörper

Target: SLC24A1 (Solute Carrier Family 24 (Sodium/potassium/calcium Exchanger), Member 1 (SLC24A1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC24A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLC24 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQLSRRPVAKVMALEDLSKPGDGAIAVDELQDNKKLKLPSLLTRGSSSTS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC24A1 Blocking Peptide, catalog no. 33R-2672, is also available for use as a blocking control in assays to test for specificity of this SLC24A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC24A1

Target: SLC24A1 (Solute Carrier Family 24 (Sodium/potassium/calcium Exchanger), Member 1 (SLC24A1))

Andere Bezeichnung: SLC24A1 (SLC24A1 Produkte)

Synonyme: SLC24A1 antikoerper, si:ch211-117i10.3 antikoerper, CSNB1D antikoerper, HsT17412 antikoerper, NCKX antikoerper, NCKX1 antikoerper, RODX antikoerper, Nckx1 antikoerper, solute carrier family 24 (sodium/potassium/calcium exchanger), member 1 antikoerper, solute carrier family 24 member 1 antikoerper, Slc24a1 antikoerper, SLC24A1 antikoerper, slc24a1 antikoerper

Hintergrund: SLC24A1 belongs to a family of potassium-dependent sodium/calcium exchangers. Members of this family have 2 large hydrophilic loops and 2 sets of multiple transmembrane-spanning segments.SLC24A1 belongs to a family of potassium-dependent sodium/calcium exchangers.

Molekulargewicht: 121 kDa (MW of target protein)

Pathways: Phototransduction