ABCB9 Antikörper

Produktnummer ABIN635922

Produktdetails anti-ABCB9 Antikörper

Target: ABCB9 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 9 (ABCB9))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ABCB9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ABCB9 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLWKAVVVTLAFMSVDICVTTAIYVFSHLDRSLLEDIRHFNIFDSVLDLW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ABCB9 Blocking Peptide, catalog no. 33R-8059, is also available for use as a blocking control in assays to test for specificity of this ABCB9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCB9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ABCB9

Target: ABCB9 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 9 (ABCB9))

Andere Bezeichnung: ABCB9 (ABCB9 Produkte)

Synonyme: ABCB9 antikoerper, si:dkey-21k4.3 antikoerper, EST122234 antikoerper, TAPL antikoerper, mKIAA1520 antikoerper, Tapl antikoerper, ATP binding cassette subfamily B member 9 antikoerper, ATP-binding cassette, sub-family B (MDR/TAP), member 9 antikoerper, ABCB9 antikoerper, abcb9 antikoerper, Abcb9 antikoerper

Hintergrund: ABCB9, a membrane-associated protein, is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABCB9 is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. The function of this half-transporter has not yet been determined, however, this protein may play a role in lysosomes.

Molekulargewicht: 80 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process