ZIP2 Antikörper

Produktnummer ABIN635913

Produktdetails anti-ZIP2 Antikörper

Target: ZIP2 (Slc39a2) (Solute Carrier Family 39 (Zinc Transporter), Member 2 (Slc39a2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZIP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLC39 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIESQIQKFMVQNRSASERNSSGDADSAHMEYPYGELIISLGFFFVFFLE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC39A2 Blocking Peptide, catalog no. 33R-2468, is also available for use as a blocking control in assays to test for specificity of this SLC39A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZIP2

Target: ZIP2 (Slc39a2) (Solute Carrier Family 39 (Zinc Transporter), Member 2 (Slc39a2))

Andere Bezeichnung: SLC39A2 (Slc39a2 Produkte)

Synonyme: 6A1 antikoerper, ETI-1 antikoerper, ZIP-2 antikoerper, ZIP2 antikoerper, F730005G13Rik antikoerper, Gm1789 antikoerper, Gm289 antikoerper, Zip2 antikoerper, solute carrier family 39 member 2 antikoerper, solute carrier family 39 (zinc transporter), member 2 antikoerper, SLC39A2 antikoerper, Slc39a2 antikoerper

Hintergrund: This gene encodes a member of the ZIP family of metal ion transporters. The encoded protein functions as a zinc transporter. Mutations in this gene may be associated with susceptibility to carotid artery disease.

Molekulargewicht: 33 kDa (MW of target protein)

Pathways: Autophagie