PQLC1 Antikörper (Middle Region)

Produktnummer ABIN635905

Produktdetails anti-PQLC1 Antikörper

Target: PQLC1 (PQ Loop Repeat Containing 1 (PQLC1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PQLC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PQLC1 antibody was raised against the middle region of PQLC1

Aufreinigung: Affinity purified

Immunogen: PQLC1 antibody was raised using the middle region of PQLC1 corresponding to a region with amino acids TYLSIDSALFVETLGFLAVLTEAMLGVPQLYRNHRHQSTEGMSIKMVLMW

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PQLC1 Blocking Peptide, catalog no. 33R-9395, is also available for use as a blocking control in assays to test for specificity of this PQLC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PQLC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PQLC1

Target: PQLC1 (PQ Loop Repeat Containing 1 (PQLC1))

Andere Bezeichnung: PQLC1 (PQLC1 Produkte)

Synonyme: 2310009N05Rik antikoerper, 4933425L21Rik antikoerper, 5730564E11Rik antikoerper, C78974 antikoerper, pqlc1 antikoerper, PQ loop repeat containing 1 antikoerper, PQ loop repeat containing 1, gene 1 L homeolog antikoerper, PQLC1 antikoerper, Pqlc1 antikoerper, pqlc1.1.L antikoerper

Hintergrund: PQLC1 is a multi-pass membrane protein. It contains 2 PQ-loop domains. The exact function of PQLC1 remains unknown.

Molekulargewicht: 30 kDa (MW of target protein)