PTPRA Antikörper (C-Term)

Produktnummer ABIN635883

Produktdetails anti-PTPRA Antikörper

Target: PTPRA (Protein tyrosine Phosphatase, Receptor Type, A (PTPRA))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PTPRA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PTPRA antibody was raised against the C terminal of PTPRA

Aufreinigung: Affinity purified

Immunogen: PTPRA antibody was raised using the C terminal of PTPRA corresponding to a region with amino acids SRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQQQSGNHPITVHCSAG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PTPRA Blocking Peptide, catalog no. 33R-8769, is also available for use as a blocking control in assays to test for specificity of this PTPRA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTPRA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PTPRA

Target: PTPRA (Protein tyrosine Phosphatase, Receptor Type, A (PTPRA))

Andere Bezeichnung: PTPRA (PTPRA Produkte)

Synonyme: PTPRA antikoerper, heptp antikoerper, hlpr antikoerper, hptpa antikoerper, hptpalpha antikoerper, lrp antikoerper, ptpa antikoerper, ptprl2 antikoerper, r-ptp-alpha antikoerper, rptpa antikoerper, HEPTP antikoerper, HLPR antikoerper, HPTPA antikoerper, HPTPalpha antikoerper, LRP antikoerper, PTPA antikoerper, PTPRL2 antikoerper, R-PTP-alpha antikoerper, RPTPA antikoerper, Ptpa antikoerper, Ptpalpha antikoerper, Rptpalpha antikoerper, Rptra antikoerper, Rptralpha antikoerper, RPTP[a] antikoerper, zf-RPTP[a] antikoerper, ptpa-a antikoerper, protein tyrosine phosphatase, receptor type A antikoerper, protein tyrosine phosphatase, receptor type, A antikoerper, protein tyrosine phosphatase, receptor type A S homeolog antikoerper, PTPRA antikoerper, ptpra antikoerper, Ptpra antikoerper, ptpra.S antikoerper

Hintergrund: PTPRA is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. PTPRA contains an extracellular domain, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, and thus represents a receptor-type PTP. PTPRA has been shown to dephosphorylate and activate Src family tyrosine kinases, and is implicated in the regulation of integrin signaling, cell adhesion and proliferation.

Molekulargewicht: 89 kDa (MW of target protein)